Contact Molecules for Homologous Proteins | ||||
[Full Bars] |
[SiteTable] |
|
[Back to Search Page] |
[Back to HOMCOS] |
[SupCon3D] |
[help] |
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100] | [show] [download] [help] |
PID | QueryLength | Homolgous Sequence in PDB | UniProt Query | TITLE |
8219 | 601 | 170 | YP_009725308.1() | |
QUERYSEQ |
AVGACVLCNSQTSLRCGACIRRPFLCCKCCYDHVISTSHKLVLSVNPYVCNAPGCDVTDVTQLYLGGMSYYCKSHKPPISFPLCANGQVFGLYKNTCVGSDNVTDFNAIATCDWTNAGDYILANTCTERLKLFAAETLKATEETFKLSYG IATVREVLSDRELHLSWEVGKPRPPLNRNYVFTGYRVTKNSKVQIGEYTFEKGDYGDAVVYRGTTTYKLNVGDYFVLTSHTVMPLSAPTLVPQEHYVRITGLYPTLNISDEFSSNVANYQKVGMQKYSTLQGPPGTGKSHFAIGLALYYP SARIVYTACSHAAVDALCEKALKYLPIDKCSRIIPARARVECFDKFKVNSTLEQYVFCTVNALPETTADIVVFDEISMATNYDLSVVNARLRAKHYVYIGDPAQLPAPRTLLTKGTLEPEYFNSVCRLMKTIGPDMFLGTCRRCPAEIVD TVSALVYDNKLKAHKDKSAQCFKMFYKGVITHDVSSAINRPQIGVVREFLTRNPAWRKAVFISPYNSQNAVASKILGLPTQTVDSSQGSEYDYVIFTQTTETAHSCNVNRFNVAITRAKVGILCIMSDRDLYDKLQFTSLEIPRRNVATL Q |
601 | region | name | description |
1-601 | DISORDER | predicted by DISOPRED |
MONOMER | |||||||
601 | |||||||
pdb_id | a1 | identity[%]2 | description | ||||
7cxm | H | 100.0 | R1AB_SARS2 Helicase | ||||
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue. |
HETERO | |||||||
601 | pdb_id | contact mol | homologue | ||||
a3 | description | a4 | identity[%]5 | Ncon6 | description | ||
6xez[17] | A | R1AB_SARS2 RNA-directed RNA polymerase[926 aa] | E | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Helicase | |
7cxn[1] | A | R1AB_SARS2 RNA-directed RNA polymerase[926 aa] | H | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Helicase | |
6xez[1] | C | R1AB_SARS2 Non-structural protein 7[73 aa] | E | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Helicase | |
6xez[3] | D | R1AB_SARS2 Non-structural protein 8[186 aa] | E | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Helicase | |
6xez[2] | B | R1AB_SARS2 Non-structural protein 8[186 aa] | F | 100.0 /100.0 |
10 /10 |
R1AB_SARS2 Helicase | |
7cxm[26] | B | R1AB_SARS2 Non-structural protein 8[187 aa] | H | 100.0 /100.0 |
11 /11 |
R1AB_SARS2 Helicase | |
7cxm[2] | D | R1AB_SARS2 Non-structural protein 8[186 aa] | I | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Helicase | |
7cyq[12] | B | R1AB_SARS2 Non-structural protein 8[187 aa] | G | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Helicase | |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
NUCLEOTIDE | |||||||
601 | pdb_id | contact mol | homologue | ||||
a3 | description | a4 | identity[%]5 | Ncon6 | description | ||
7cxm[2] | G | RNA (5'-R(P*UP*UP*UP*UP*UP*U)-3') | I | 100.0 /100.0 |
20 /20 |
R1AB_SARS2 Helicase | |
7krn[2] | G | RNA (43-MER) | E | 100.0 /100.0 |
32 /32 |
R1AB_SARS2 Helicase | |
8gw1[1] | F | Template | G | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Helicase | |
8gwb[4] | J | template | E | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Helicase | |
8gwe[1] | J | template | F | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Helicase nsp13 | |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
COMPOUND | |||||||
601 | pdb_id | contact mol | homologue | ||||
a3 | description | a4 | identity[%]5 | Ncon6 | description | ||
6xez[5] | R |
ADP
ADENOSINE-5'-DIPHOSPHATE[27 atoms] |
E | 100.0 /100.0 |
10 /10 |
R1AB_SARS2 Helicase | |
6xez[3] | U |
1N7
CHAPSO[36 atoms] |
E | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Helicase | |
7nn0[4] | E |
ANP
PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER[31 ato.. |
A | 100.0 /100.0 |
16 /16 |
R1AB_SARS2 SARS-CoV-2 helicase NSP13 | |
7nng[2] | C |
UJK
1-(2-methylphenyl)-1,2,3-triazole-4-carboxylic aci.. |
A | 100.0 /100.0 |
8 /8 |
R1AB_SARS2 SARS-CoV-2 helicase NSP13 | |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
METAL | |||||||
601 | pdb_id | contact mol | homologue | ||||
a3 | description | a4 | identity[%]5 | Ncon6 | description | ||
5rob[32] | C |
ZN
ZINC ION[1 atoms] |
A | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Helicase | |
5rob[32] | D |
ZN
ZINC ION[1 atoms] |
A | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Helicase | |
5rob[44] | E |
ZN
ZINC ION[1 atoms] |
A | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Helicase | |
5wwp[12] | C |
ZN
ZINC ION[1 atoms] |
A | 100.0 /72.3 |
4 /4 |
K0BWD0_9BETC ORF1ab | |
5wwp[12] | D |
ZN
ZINC ION[1 atoms] |
A | 100.0 /72.3 |
4 /4 |
K0BWD0_9BETC ORF1ab | |
6xez[5] | O |
ZN
ZINC ION[1 atoms] |
E | 100.0 /100.0 |
6 /6 |
R1AB_SARS2 Helicase | |
6xez[5] | P |
ZN
ZINC ION[1 atoms] |
E | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Helicase | |
6xez[5] | Q |
ZN
ZINC ION[1 atoms] |
E | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Helicase | |
6xez[5] | T |
MG
MAGNESIUM ION[1 atoms] |
E | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Helicase | |
7nn0[1] | I |
MG
MAGNESIUM ION[1 atoms] |
A | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 SARS-CoV-2 helicase NSP13 | |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
HOMO | |||||||
601 | pdb_id | contact mol | homologue | ||||
a3 | description | a4 | identity[%]5 | Ncon6 | description | ||
6xez[13] | F | R1AB_SARS2 Helicase[596 aa] | E | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Helicase | |
6xez[15] | E | R1AB_SARS2 Helicase[596 aa] | F | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Helicase | |
7cxm[2] | H | R1AB_SARS2 Helicase[596 aa] | I | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Helicase | |
7nio[2] | B | R1AB_SARS2 SARS-CoV-2 helicase NSP13[585 aa] | A | 100.0 /100.0 |
14 /14 |
R1AB_SARS2 SARS-CoV-2 helicase NSP13 | |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
PRECIPITANT | |||||||
601 | pdb_id | contact mol | homologue | ||||
a3 | description | a4 | identity[%]5 | Ncon6 | description | ||
5rob[12] | F |
PO4
PHOSPHATE ION[5 atoms] |
A | 100.0 /100.0 |
6 /6 |
R1AB_SARS2 Helicase | |
6xez[5] | S |
AF3
ALUMINUM FLUORIDE[4 atoms] |
E | 100.0 /100.0 |
7 /7 |
R1AB_SARS2 Helicase | |
5wwp[3] | F |
SO4
SULFATE ION[5 atoms] |
A | 100.0 /72.3 |
5 /5 |
K0BWD0_9BETC ORF1ab | |
5wwp[1] | J |
SO4
SULFATE ION[5 atoms] |
B | 100.0 /72.6 |
6 /6 |
K0BWD0_9BETC ORF1ab | |
5wwp[1] | K |
SO4
SULFATE ION[5 atoms] |
B | 100.0 /72.6 |
4 /4 |
K0BWD0_9BETC ORF1ab | |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. |