#WARNING:no index is registered index "YP_009725308.1" in "https://rest.uniprot.org/uniprotkb/" url "https://rest.uniprot.org/uniprotkb/YP_009725308.1.txt".
Please visit the UniProt website(https://www.uniprot.org), and get a proper ID/AC for your query protein.

Contact Molecules for Homologous Proteins

[Full Bars]
[SiteTable]


Summary Bars[0 %]


[Back to Search Page]
[Back to HOMCOS]

[SupCon3D]
[help] 		seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
8219 601 170 YP_009725308.1()
QUERYSEQ 
AVGACVLCNSQTSLRCGACIRRPFLCCKCCYDHVISTSHKLVLSVNPYVCNAPGCDVTDVTQLYLGGMSYYCKSHKPPISFPLCANGQVFGLYKNTCVGSDNVTDFNAIATCDWTNAGDYILANTCTERLKLFAAETLKATEETFKLSYG
IATVREVLSDRELHLSWEVGKPRPPLNRNYVFTGYRVTKNSKVQIGEYTFEKGDYGDAVVYRGTTTYKLNVGDYFVLTSHTVMPLSAPTLVPQEHYVRITGLYPTLNISDEFSSNVANYQKVGMQKYSTLQGPPGTGKSHFAIGLALYYP
SARIVYTACSHAAVDALCEKALKYLPIDKCSRIIPARARVECFDKFKVNSTLEQYVFCTVNALPETTADIVVFDEISMATNYDLSVVNARLRAKHYVYIGDPAQLPAPRTLLTKGTLEPEYFNSVCRLMKTIGPDMFLGTCRRCPAEIVD
TVSALVYDNKLKAHKDKSAQCFKMFYKGVITHDVSSAINRPQIGVVREFLTRNPAWRKAVFISPYNSQNAVASKILGLPTQTVDSSQGSEYDYVIFTQTTETAHSCNVNRFNVAITRAKVGILCIMSDRDLYDKLQFTSLEIPRRNVATL
Q
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [YP_009725308.1()]

601
region name description
1-601 DISORDER predicted by DISOPRED

MONOMER
601
pdb_id a1 identity[%]2 description
7cxm H 100.0 R1AB_SARS2 Helicase 
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue.
HETERO
601 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
6xez[17] A R1AB_SARS2 RNA-directed RNA polymerase[926 aa] E 100.0
/100.0		 3
/3		 R1AB_SARS2 Helicase
7cxn[1] A R1AB_SARS2 RNA-directed RNA polymerase[926 aa] H 100.0
/100.0		 1
/1		 R1AB_SARS2 Helicase
6xez[1] C R1AB_SARS2 Non-structural protein 7[73 aa] E 100.0
/100.0		 1
/1		 R1AB_SARS2 Helicase
6xez[3] D R1AB_SARS2 Non-structural protein 8[186 aa] E 100.0
/100.0		 4
/4		 R1AB_SARS2 Helicase
6xez[2] B R1AB_SARS2 Non-structural protein 8[186 aa] F 100.0
/100.0		 10
/10		 R1AB_SARS2 Helicase
7cxm[26] B R1AB_SARS2 Non-structural protein 8[187 aa] H 100.0
/100.0		 11
/11		 R1AB_SARS2 Helicase
7cxm[2] D R1AB_SARS2 Non-structural protein 8[186 aa] I 100.0
/100.0		 3
/3		 R1AB_SARS2 Helicase
7cyq[12] B R1AB_SARS2 Non-structural protein 8[187 aa] G 100.0
/100.0		 2
/2		 R1AB_SARS2 Helicase
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
NUCLEOTIDE
601 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
7cxm[2] G RNA (5'-R(P*UP*UP*UP*UP*UP*U)-3') I 100.0
/100.0		 20
/20		 R1AB_SARS2 Helicase
7krn[2] G RNA (43-MER) E 100.0
/100.0		 32
/32		 R1AB_SARS2 Helicase
8gw1[1] F Template G 100.0
/100.0		 1
/1		 R1AB_SARS2 Helicase
8gwb[4] J template E 100.0
/100.0		 5
/5		 R1AB_SARS2 Helicase
8gwe[1] J template F 100.0
/100.0		 1
/1		 R1AB_SARS2 Helicase nsp13
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
COMPOUND
601 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
6xez[5] R ADP
ADENOSINE-5'-DIPHOSPHATE[27 atoms] 		E 100.0
/100.0		 10
/10		 R1AB_SARS2 Helicase
6xez[3] U 1N7
CHAPSO[36 atoms] 		E 100.0
/100.0		 3
/3		 R1AB_SARS2 Helicase
7nn0[4] E ANP
PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER[31 ato.. 		A 100.0
/100.0		 16
/16		 R1AB_SARS2 SARS-CoV-2 helicase NSP13
7nng[2] C UJK
1-(2-methylphenyl)-1,2,3-triazole-4-carboxylic aci.. 		A 100.0
/100.0		 8
/8		 R1AB_SARS2 SARS-CoV-2 helicase NSP13
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
METAL
601 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
5rob[32] C ZN
ZINC ION[1 atoms] 		A 100.0
/100.0		 4
/4		 R1AB_SARS2 Helicase
5rob[32] D ZN
ZINC ION[1 atoms] 		A 100.0
/100.0		 5
/5		 R1AB_SARS2 Helicase
5rob[44] E ZN
ZINC ION[1 atoms] 		A 100.0
/100.0		 5
/5		 R1AB_SARS2 Helicase
5wwp[12] C ZN
ZINC ION[1 atoms] 		A 100.0
/72.3		 4
/4		 K0BWD0_9BETC ORF1ab
5wwp[12] D ZN
ZINC ION[1 atoms] 		A 100.0
/72.3		 4
/4		 K0BWD0_9BETC ORF1ab
6xez[5] O ZN
ZINC ION[1 atoms] 		E 100.0
/100.0		 6
/6		 R1AB_SARS2 Helicase
6xez[5] P ZN
ZINC ION[1 atoms] 		E 100.0
/100.0		 5
/5		 R1AB_SARS2 Helicase
6xez[5] Q ZN
ZINC ION[1 atoms] 		E 100.0
/100.0		 4
/4		 R1AB_SARS2 Helicase
6xez[5] T MG
MAGNESIUM ION[1 atoms] 		E 100.0
/100.0		 3
/3		 R1AB_SARS2 Helicase
7nn0[1] I MG
MAGNESIUM ION[1 atoms] 		A 100.0
/100.0		 3
/3		 R1AB_SARS2 SARS-CoV-2 helicase NSP13
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
HOMO
601 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
6xez[13] F R1AB_SARS2 Helicase[596 aa] E 100.0
/100.0		 4
/4		 R1AB_SARS2 Helicase
6xez[15] E R1AB_SARS2 Helicase[596 aa] F 100.0
/100.0		 5
/5		 R1AB_SARS2 Helicase
7cxm[2] H R1AB_SARS2 Helicase[596 aa] I 100.0
/100.0		 3
/3		 R1AB_SARS2 Helicase
7nio[2] B R1AB_SARS2 SARS-CoV-2 helicase NSP13[585 aa] A 100.0
/100.0		 14
/14		 R1AB_SARS2 SARS-CoV-2 helicase NSP13
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
PRECIPITANT
601 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
5rob[12] F PO4
PHOSPHATE ION[5 atoms] 		A 100.0
/100.0		 6
/6		 R1AB_SARS2 Helicase
6xez[5] S AF3
ALUMINUM FLUORIDE[4 atoms] 		E 100.0
/100.0		 7
/7		 R1AB_SARS2 Helicase
5wwp[3] F SO4
SULFATE ION[5 atoms] 		A 100.0
/72.3		 5
/5		 K0BWD0_9BETC ORF1ab
5wwp[1] J SO4
SULFATE ION[5 atoms] 		B 100.0
/72.6		 6
/6		 K0BWD0_9BETC ORF1ab
5wwp[1] K SO4
SULFATE ION[5 atoms] 		B 100.0
/72.6		 4
/4		 K0BWD0_9BETC ORF1ab
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.