#WARNING:no index is registered index "YP_009725305.1" in "https://rest.uniprot.org/uniprotkb/" url "https://rest.uniprot.org/uniprotkb/YP_009725305.1.txt".
Please visit the UniProt website(https://www.uniprot.org), and get a proper ID/AC for your query protein.

Contact Molecules for Homologous Proteins

[Summary Bars]
[SiteTable]


Full Bars[40 %]


[Back to Search Page]
[Back to HOMCOS]

[SupCon3D]
[help] 		seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
6937 113 60 YP_009725305.1()
QUERYSEQ 
NNELSPVALRQMSCAAGTTQTACTDDNALAYYNTTKGGRFVLALLSDLQDLKWARFPKSDGTGTIYTELEPPCRFVTDTPKGPKVKYLYFIKGLNNLNRGMVLGSLAATVRLQ
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [YP_009725305.1()]

113
region name description
1-8 DISORDER predicted by DISOPRED

MONOMER
113
pdb_id a1 identity[%]2 description
6w4b B 100.0 R1AB_SARS2 Non-structural protein 9
7kri B 100.0 R1AB_SARS2 Non-structural protein 9
7kri A 100.0 R1AB_SARS2 Non-structural protein 9
7n3k G 100.0 R1AB_SARS2 Non-structural protein 9
8sqj E 100.0 R1AB_SARS2 Non-structural protein 9
8gwo I 100.0 R1AB_SARS2 Non-structural protein 9
8gwn I 100.0 R1AB_SARS2 Non-structural protein 9
8sqk E 100.0 R1AB_SARS2 Non-structural protein 9
7eiz E 100.0 R1AB_SARS2 Non-structural protein 9
8gwi I 100.0 R1AB_SARS2 Non-structural protein 9
8gw1 I 100.0 R1AB_SARS2 Non-structural protein 9
8gwm G 100.0 R1AB_SARS2 Non-structural protein 9
8gwk I 100.0 R1AB_SARS2 Non-structural protein 9
8gwe G 100.0 R1AB_SARS2 Non-structural protein 9
6wxd A 100.0 R1AB_SARS2 Non-structural protein 9
8gwb G 100.0 R1AB_SARS2 Non-structural protein 9
7egq F 100.0