Contact Molecules for Homologous Proteins | ||||
![]() [Full Bars] |
![]() [SiteTable] |
|
![]() [Back to Search Page] |
![]() [Back to HOMCOS] |
![]() [SupCon3D] |
![]() [help] |
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100] | ![]() [show] [download] [help] |
PID | QueryLength | Homolgous Sequence in PDB | UniProt Query | TITLE |
2624989 | 215 | 29 | P09429(HMGB1_HUMAN) | RecName: Full=High mobility group protein B1;AltName: Full=High mobility group protein 1; Short=HMG-1; |
QUERYSEQ |
MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAK LKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEEDEEDEEDEEEEEDEEDEDEEEDDDDE |
215 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
region | name | description |
![]() |
1-215 | CHAIN | /note="High mobility group protein B1" /id="PRO_0000048526" |
![]() ![]() ![]() |
9-79 | DNA_BIND | /note="HMG box 1" |
![]() ![]() ![]() |
95-163 | DNA_BIND | /note="HMG box 2" |
![]() ![]() |
1-97 | REGION | /note="Sufficient for interaction with HAVCR2" |
![]() ![]() ![]() |
3-15 | REGION | /note="LPS binding (delipidated)" |
![]() ![]() ![]() |
76-95 | REGION | /note="Disordered" |
![]() ![]() ![]() |
80-96 | REGION | /note="LPS binding (Lipid A)" |
![]() ![]() ![]() |
89-108 | REGION | /note="Cytokine-stimulating activity" |
![]() ![]() ![]() |
150-183 | REGION | /note="Binding to AGER/RAGE" |
![]() ![]() |
161-215 | REGION | /note="Disordered" |
![]() ![]() ![]() |
76-94 | COMPBIAS | /note="Basic and acidic residues" |
![]() ![]() ![]() |
161-187 | COMPBIAS | /note="Basic and acidic residues" |
![]() ![]() |
188-215 | COMPBIAS | /note="Acidic residues" |
![]() ![]() |
1-10 | BINDING | /ligand="heparin" /ligand_id="ChEBI:CHEBI:28304" |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
1-215 | DISORDER | predicted by DISOPRED |
![]() |
|||||||
215 | |||||||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
pdb_id | a1 | identity[%]2 | description | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | 100.0 | HMGB1_HUMAN High mobility group protein B1 | |||
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue. |
![]() |
|||||||
215 | pdb_id | contact mol | homologue | ||||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
a3 | description | a4 | identity[%]5 | Ncon6 | description | |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | P53_HUMAN Cellular tumor antigen p53[47 aa] | A | 100.0 /100.0 |
17 /17 |
HMGB1_HUMAN High mobility group protein B1 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | RAG1_MOUSE V(D)J recombination-activating protein 1[614 aa] | G | 100.0 /100.0 |
3 /3 |
HMGB1_HUMAN High mobility group protein B1 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | RAGE_HUMAN Advanced glycosylation end product-specific recept.. | A | 100.0 /100.0 |
14 /14 |
HMGB1_HUMAN High mobility group protein B1 |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
![]() |
|||||||
215 | pdb_id | contact mol | homologue | ||||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
a3 | description | a4 | identity[%]5 | Ncon6 | description | |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | DNA (5'-D(*CP*CP*(5IU)P*CP*TP*CP*TP*GP*GP*AP*CP*CP.. | C | 100.0 /100.0 |
9 /9 |
HMG1_RAT HIGH MOBILITY GROUP 1 PROTEIN |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | DNA (5'-D(*GP*GP*AP*AP*GP*GP*TP*CP*CP*AP*GP*AP*GP*.. | C | 100.0 /100.0 |
10 /10 |
HMG1_RAT HIGH MOBILITY GROUP 1 PROTEIN |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | DNA (5'-D(*AP*TP*AP*TP*CP*GP*AP*TP*AP*T)-3') | A | 100.0 /100.0 |
11 /11 |
HMGB1_RAT High mobility group protein B1 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
D | DNA (5'-D(*AP*TP*AP*TP*CP*GP*AP*TP*AP*T)-3') | A | 100.0 /100.0 |
10 /11 |
HMGB1_RAT High mobility group protein B1 |
![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
F | DNA (5'-D(*AP*TP*AP*TP*CP*GP*AP*TP*AP*T)-3') | A | 100.0 /100.0 |
2 /4 |
HMGB1_RAT High mobility group protein B1 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
I | DNA (39-MER) | E | 100.0 /100.0 |
10 /10 |
HMGB1_MOUSE HMGB1 A-B box |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
K | DNA chain M | E | 100.0 /100.0 |
11 /11 |
HMGB1_MOUSE HMGB1 A-B box |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
H | DNA (40-MER) | E | 100.0 /100.0 |
7 /7 |
HMGB1_MOUSE HMGB1 A-B box |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
J | DNA (40-MER) | E | 100.0 /100.0 |
10 /10 |
HMGB1_MOUSE HMGB1 A-B box |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
H | DNA (60-MER) | K | 100.0 /100.0 |
12 /12 |
HMGB1_HUMAN High mobility group protein B1 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
J | DNA (41-MER) | K | 100.0 /100.0 |
11 /11 |
HMGB1_HUMAN High mobility group protein B1 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
K | DNA (41-MER) | G | 100.0 /100.0 |
12 /12 |
HMGB1_HUMAN High mobility group protein B1 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
F | DNA (60-MER) | G | 100.0 /100.0 |
10 /10 |
HMGB1_HUMAN High mobility group protein B1 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
H | Nicked 23RSS intermediate reverse strand | E | 100.0 /100.0 |
10 /10 |
HMGB1_HUMAN High mobility group protein B1 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
J | Nicked 23RSS intermediate forward strand | E | 100.0 /100.0 |
6 /6 |
HMGB1_HUMAN High mobility group protein B1 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
H | Intact 23RSS substrate reverse strand | E | 100.0 /100.0 |
5 /5 |
HMGB1_HUMAN High mobility group protein B1 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
I | Intact 23RSS substrate reverse strand | E | 100.0 /100.0 |
10 /10 |
HMGB1_HUMAN High mobility group protein B1 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
J | Intact 23RSS substrate forward strand | E | 100.0 /100.0 |
5 /5 |
HMGB1_HUMAN High mobility group protein B1 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
E | DNA (57-MER) | I | 100.0 /100.0 |
7 /7 |
HMGB1_HUMAN High mobility group protein B1 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
E | DNA (57-MER) | I | 100.0 /100.0 |
7 /7 |
HMGB1_HUMAN High mobility group protein B1 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
H | DNA (57-MER) | I | 100.0 /100.0 |
7 /7 |
HMGB1_HUMAN High mobility group protein B1 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
H | DNA (57-MER) | I | 100.0 /100.0 |
8 /8 |
HMGB1_HUMAN High mobility group protein B1 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
F | DNA (46-MER) | J | 100.0 /100.0 |
8 /8 |
HMGB1_HUMAN High mobility group protein B1 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
F | DNA (46-MER) | J | 100.0 /100.0 |
8 /8 |
HMGB1_HUMAN High mobility group protein B1 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
G | DNA (46-MER) | J | 100.0 /100.0 |
5 /5 |
HMGB1_HUMAN High mobility group protein B1 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
G | DNA (46-MER) | J | 100.0 /100.0 |
3 /3 |
HMGB1_HUMAN High mobility group protein B1 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
G | DNA (57-MER) | I | 100.0 /100.0 |
5 /5 |
HMGB1_HORSE High mobility group protein B1 |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
![]() |
|||||||
215 | pdb_id | contact mol | homologue | ||||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
a3 | description | a4 | identity[%]5 | Ncon6 | description | |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | HMGB1_RAT High mobility group protein B1[75 aa] | A | 100.0 /100.0 |
5 /5 |
HMGB1_RAT High mobility group protein B1 |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
![]() |
|||||||
215 | pdb_id | contact mol | homologue | ||||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
a3 | description | a4 | identity[%]5 | Ncon6 | description | |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B |
BME
|
A | 100.0 /100.0 |
4 /4 |
HMG1_CRIGR HIGH MOBILITY GROUP PROTEIN 1 |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. |