#WARNING:no index is registered index "YP_009725300.1" in "https://rest.uniprot.org/uniprotkb/" url "https://rest.uniprot.org/uniprotkb/YP_009725300.1.txt".
Please visit the UniProt website(https://www.uniprot.org), and get a proper ID/AC for your query protein.

Contact Molecules for Homologous Proteins


[Summary Bars]

[SiteTable]


Full Bars[30 %]


[Back to Search Page]

[Back to HOMCOS]

[SupCon3D]

[help]
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
2507403 500 9 YP_009725300.1()
QUERYSEQ
KIVNNWLKQLIKVTLVFLFVAAIFYLITPVHVMSKHTDFSSEIIGYKAIDGGVTRDIASTDTCFANKHADFDTWFSQRGGSYTNDKACPLIAAVITREVGFVVPGLPGTILRTTNGDFLHFLPRVFSAVGNICYTPSKLIEYTDFATSAC
VLAAECTIFKDASGKPVPYCYDTNVLEGSVAYESLRPDTRYVLMDGSIIQFPNTYLEGSVRVVTTFDSEYCRHGTCERSEAGVCVSTSGRWVLNNDYYRSLPGVFCGVDAVNLLTNMFTPLIQPIGALDISASIVAGGIVAIVVTCLAYY
FMRFRRAFGEYSHVVAFNTLLFLMSFTVLCLTPVYSFLPGVYSVIYLYLTFYLTNDVSFLAHIQWMVMFTPLVPFWITIAYIICISTKHFYWFFSNYLKRRVVFNGVSFSTFEEAALCTFLLNKEMYLKLRSDVLLPLTQYNRYLALYNK
YKYFSGAMDTTSYREAACCHLAKALNDFSNSGSDVLYQPPQTSITSAVLQ
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [YP_009725300.1()]

500
region name description
1-500 DISORDER predicted by DISOPRED

MONOMER
500
pdb_id a1 identity[%]2 description
3vcb B 61.4 Q9J3E9_9BETC RNA-directed RNA polymerase
3vcb A 61.4 Q9J3E9_9BETC RNA-directed RNA polymerase
3vc8 B 61.9 Q9J3E9_9BETC RNA-directed RNA polymerase
3vc8 A 64.1 Q9J3E9_9BETC RNA-directed RNA polymerase
3gzf A 40.4 R1AB_FIPV Replicase polyprotein 1ab
3gzf C 41.1 R1AB_FIPV Replicase polyprotein 1ab
3gzf D 41.1 R1AB_FIPV Replicase polyprotein 1ab
3gzf B 40.7 R1AB_FIPV Replicase polyprotein 1ab
3gzf E 41.2 R1AB_FIPV Replicase polyprotein 1ab
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue.
HOMO
500 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
3vc8 B Q9J3E9_9BETC RNA-directed RNA polymerase[85 aa] A 75.0
/64.1
4
/4
Q9J3E9_9BETC RNA-directed RNA polymerase
3vc8 A Q9J3E9_9BETC RNA-directed RNA polymerase[81 aa] B 75.0
/61.9
4
/4
Q9J3E9_9BETC RNA-directed RNA polymerase
3vcb B Q9J3E9_9BETC RNA-directed RNA polymerase[89 aa] A 60.9
/61.4
23
/23
Q9J3E9_9BETC RNA-directed RNA polymerase
3vcb A Q9J3E9_9BETC RNA-directed RNA polymerase[89 aa] B 59.1
/61.4
22
/22
Q9J3E9_9BETC RNA-directed RNA polymerase
3gzf C R1AB_FIPV Replicase polyprotein 1ab[92 aa] A 37.5
/40.4
16
/16
R1AB_FIPV Replicase polyprotein 1ab
3gzf D R1AB_FIPV Replicase polyprotein 1ab[91 aa] B 40.0
/40.7
15
/15
R1AB_FIPV Replicase polyprotein 1ab
3gzf A R1AB_FIPV Replicase polyprotein 1ab[96 aa] C 47.6
/41.1
21
/21
R1AB_FIPV Replicase polyprotein 1ab
3gzf B R1AB_FIPV Replicase polyprotein 1ab[93 aa] D 50.0
/41.1
20
/20
R1AB_FIPV Replicase polyprotein 1ab
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
PRECIPITANT
500 pdb_id contact mol homologue
a3 description a4 identity[%]5 Ncon6 description
3gzf F SO4
SULFATE ION[5 atoms]
C 50.0
/41.1
4
/4
R1AB_FIPV Replicase polyprotein 1ab
3gzf G SO4
SULFATE ION[5 atoms]
D 50.0
/41.1
4
/4
R1AB_FIPV Replicase polyprotein 1ab
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.