Contact Molecules for Homologous Proteins | ||||
![]() [Summary Bars] |
![]() [SiteTable] |
|
![]() [Back to Search Page] |
![]() [Back to HOMCOS] |
![]() [SupCon3D] |
![]() [help] |
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100] | ![]() [show] [download] [help] |
PID | QueryLength | Homolgous Sequence in PDB | UniProt Query | TITLE |
1884054 | 113 | 44 | YP_009725305.1() | |
QUERYSEQ |
NNELSPVALRQMSCAAGTTQTACTDDNALAYYNTTKGGRFVLALLSDLQDLKWARFPKSDGTGTIYTELEPPCRFVTDTPKGPKVKYLYFIKGLNNLNRGMVLGSLAATVRLQ |
113 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
region | name | description |
![]() ![]() ![]() ![]() |
1-8 | DISORDER | predicted by DISOPRED |
![]() |
|||||||
113 | |||||||
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
pdb_id | a1 | identity[%]2 | description | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | 100.0 | R1AB_SARS2 Non-structural protein 9 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | 100.0 | R1AB_SARS2 Non-structural protein 9 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | 100.0 | R1AB_SARS2 Non-structural protein 9 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
G | 100.0 | R1AB_SARS2 Non-structural protein 9 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
G | 100.0 | R1AB_SARS2 Non-structural protein 9 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
I | 100.0 | R1AB_SARS2 Non-structural protein 9 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
G | 100.0 | R1AB_SARS2 Non-structural protein 9 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
E | 100.0 | R1AB_SARS2 Non-structural protein 9 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
I | 100.0 | R1AB_SARS2 Non-structural protein 9 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
I | 100.0 | R1AB_SARS2 Non-structural protein 9 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
E | 100.0 | R1AB_SARS2 Non-structural protein 9 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
E | 100.0 | R1AB_SARS2 Non-structural protein 9 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
I | 100.0 | R1AB_SARS2 Non-structural protein 9 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
I | 100.0 | R1AB_SARS2 Non-structural protein 9 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | 100.0 | R1AB_SARS2 Non-structural protein 9 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
N | 100.0 | R1AB_SARS2 Non-structural protein 9 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
F | 100.0 | R1AB_SARS2 Non-structural protein 9 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
G | 100.0 | R1AB_SARS2 Non-structural protein 9 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
I | 100.0 | R1AB_SARS2 Non-structural protein 9 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
I | 100.0 | R1AB_SARS2 Non-structural protein 9 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
I | 100.0 | R1AB_SARS2 Non-structural protein 9 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | 100.0 | R1AB_SARS2 Non-structural protein 9 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | 100.0 | R1AB_SARS2 Non-structural protein 9 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
D | 100.0 | R1AB_SARS2 Non-structural protein 9 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
E | 100.0 | R1AB_SARS2 Non-structural protein 9 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
H | 100.0 | R1AB_SARS2 Non-structural protein 9 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
F | 100.0 | R1AB_SARS2 Non-structural protein 9 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | 100.0 | R1AB_SARS2 Non-structural protein 9 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | 100.0 | R1AB_SARS2 3C-like proteinase peptide, Non-structural protein 9 fusion | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | 100.0 | R1AB_SARS2 Non-structural protein 9 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | 100.0 | SARS-coV-2 Non-structural protein 9 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | 100.0 | SARS-coV-2 Non-structural protein 9 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | 100.0 | R1AB_SARS2 Non-structural protein 9 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | 100.0 | R1AB_SARS2 Non-structural protein 9 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
F | 100.0 | Nsp9 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | 100.0 | Nsp9 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
E | 100.0 | Nsp9 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | 100.0 | Nsp9 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | 100.0 | Nsp9 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
D | 100.0 | Nsp9 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
E | 100.0 | R1AB_SARS2 Non-structural protein 9 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | 100.0 | R1AB_SARS2 Non-structural protein 9 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
D | 100.0 | R1AB_SARS2 Non-structural protein 9 | |||
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
E | 100.0 | R1AB_SARS2 Non-structural protein 9 | |||
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue. |
![]() |
|||||||
113 | pdb_id | contact mol | homologue | ||||
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
a3 | description | a4 | identity[%]5 | Ncon6 | description | |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | R1AB_SARS2 RNA-directed RNA polymerase[926 aa] | I | 100.0 /100.0 |
12 /12 |
R1AB_SARS2 Non-structural protein 9 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | R1AB_SARS2 RNA-directed RNA polymerase[926 aa] | F | 100.0 /100.0 |
13 /13 |
R1AB_SARS2 Non-structural protein 9 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
I | R1AB_SARS2 RNA-directed RNA polymerase[926 aa] | N | 100.0 /100.0 |
13 /13 |
R1AB_SARS2 Non-structural protein 9 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | R1AB_SARS2 RNA-directed RNA polymerase[926 aa] | E | 100.0 /100.0 |
11 /11 |
R1AB_SARS2 Non-structural protein 9 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | R1AB_SARS2 RNA-directed RNA polymerase[860 aa] | E | 100.0 /100.0 |
11 /11 |
R1AB_SARS2 Non-structural protein 9 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | R1AB_SARS2 Replicase polyprotein 1ab[928 aa] | I | 100.0 /100.0 |
11 /11 |
R1AB_SARS2 Non-structural protein 9 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | R1AB_SARS2 RNA-directed RNA polymerase[926 aa] | G | 100.0 /100.0 |
11 /11 |
R1AB_SARS2 Non-structural protein 9 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | R1AB_SARS2 RNA-directed RNA polymerase[931 aa] | G | 100.0 /100.0 |
13 /13 |
R1AB_SARS2 Non-structural protein 9 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | R1AB_SARS2 RNA-directed RNA polymerase[931 aa] | I | 100.0 /100.0 |
13 /13 |
R1AB_SARS2 Non-structural protein 9 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | R1AB_SARS2 RNA-directed RNA polymerase[931 aa] | I | 100.0 /100.0 |
13 /13 |
R1AB_SARS2 Non-structural protein 9 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | R1AB_SARS2 RNA-directed RNA polymerase[931 aa] | I | 100.0 /100.0 |
13 /13 |
R1AB_SARS2 Non-structural protein 9 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | R1AB_SARS2 RNA-directed RNA polymerase[931 aa] | I | 100.0 /100.0 |
12 /12 |
R1AB_SARS2 Non-structural protein 9 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | R1AB_SARS2 RNA-directed RNA polymerase[928 aa] | G | 100.0 /100.0 |
12 /12 |
R1AB_SARS2 Non-structural protein 9 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | R1AB_SARS2 RNA-directed RNA polymerase[926 aa] | I | 100.0 /100.0 |
10 /10 |
R1AB_SARS2 Non-structural protein 9 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | R1AB_SARS2 RNA-directed RNA polymerase[926 aa] | I | 100.0 /100.0 |
12 /12 |
R1AB_SARS2 Non-structural protein 9 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | R1AB_SARS2 RNA-directed RNA polymerase[926 aa] | E | 100.0 /100.0 |
14 /14 |
R1AB_SARS2 Non-structural protein 9 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | R1AB_SARS2 RNA-directed RNA polymerase[929 aa] | E | 100.0 /100.0 |
14 /14 |
R1AB_SARS2 Non-structural protein 9 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | R1AB_SARS2 RNA-directed RNA polymerase nsp12[929 aa] | E | 100.0 /100.0 |
12 /12 |
R1AB_SARS2 Non-structural protein 9 |
![]() ![]() |
![]() |
G | R1AB_SARS2 Non-structural protein 10[131 aa] | F | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Non-structural protein 9 |
![]() ![]() |
![]() |
O | R1AB_SARS2 Non-structural protein 10[130 aa] | N | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Non-structural protein 9 |
![]() ![]() ![]() |
![]() |
H | R1AB_SARS2 Proofreading exoribonuclease[523 aa] | F | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Non-structural protein 9 |
![]() ![]() ![]() |
![]() |
P | R1AB_SARS2 Proofreading exoribonuclease[524 aa] | N | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Non-structural protein 9 |
![]() ![]() ![]() ![]() |
![]() |
I | R1AB_SARS2 Proofreading exoribonuclease[523 aa] | E | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Non-structural protein 9 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | Nanobody[127 aa] | C | 100.0 /100.0 |
15 /15 |
R1AB_SARS2 Non-structural protein 9 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | Nanobody[127 aa] | C | 100.0 /100.0 |
15 /15 |
R1AB_SARS2 Non-structural protein 9 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | Nanobody[127 aa] | C | 100.0 /100.0 |
15 /15 |
R1AB_SARS2 Non-structural protein 9 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | Nanobody[127 aa] | C | 100.0 /100.0 |
15 /15 |
R1AB_SARS2 Non-structural protein 9 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | Nanobody[127 aa] | C | 100.0 /100.0 |
15 /15 |
R1AB_SARS2 Non-structural protein 9 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | Nanobody[127 aa] | C | 100.0 /100.0 |
15 /15 |
R1AB_SARS2 Non-structural protein 9 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | Nanobody[126 aa] | D | 100.0 /100.0 |
15 /15 |
R1AB_SARS2 Non-structural protein 9 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | Nanobody[126 aa] | D | 100.0 /100.0 |
15 /15 |
R1AB_SARS2 Non-structural protein 9 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | Nanobody[126 aa] | D | 100.0 /100.0 |
15 /15 |
R1AB_SARS2 Non-structural protein 9 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | Nanobody[126 aa] | D | 100.0 /100.0 |
15 /15 |
R1AB_SARS2 Non-structural protein 9 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | Nanobody[126 aa] | D | 100.0 /100.0 |
15 /15 |
R1AB_SARS2 Non-structural protein 9 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | Nanobody[126 aa] | D | 100.0 /100.0 |
15 /15 |
R1AB_SARS2 Non-structural protein 9 |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
![]() |
|||||||
113 | pdb_id | contact mol | homologue | ||||
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
a3 | description | a4 | identity[%]5 | Ncon6 | description | |
![]() ![]() |
![]() |
H | RNA (5'-R(P*AP*U)-3') | G | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Non-structural protein 9 |
![]() ![]() |
![]() |
H | RNA (5'-R(P*AP*UP*UP*A)-3') | G | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Non-structural protein 9 |
![]() ![]() |
![]() |
H | SARS-CoV-2 5' UTR | E | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Non-structural protein 9 |
![]() ![]() |
![]() |
H | SARS-CoV-2 5' UTR | E | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Non-structural protein 9 |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
![]() |
|||||||
113 | pdb_id | contact mol | homologue | ||||
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
a3 | description | a4 | identity[%]5 | Ncon6 | description | |
![]() ![]() |
![]() |
L |
GDP
|
I | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Non-structural protein 9 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
E |
X0Y
|
A | 100.0 /100.0 |
6 /7 |
R1AB_SARS2 Non-structural protein 9 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
E |
X0Y
|
A | 100.0 /100.0 |
6 /7 |
R1AB_SARS2 Non-structural protein 9 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
F |
X0Y
|
A | 100.0 /100.0 |
3 /4 |
R1AB_SARS2 Non-structural protein 9 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
F |
X0Y
|
A | 100.0 /100.0 |
3 /4 |
R1AB_SARS2 Non-structural protein 9 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
H |
X0Y
|
B | 100.0 /100.0 |
5 /6 |
R1AB_SARS2 Non-structural protein 9 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
H |
X0Y
|
B | 100.0 /100.0 |
5 /6 |
R1AB_SARS2 Non-structural protein 9 |
![]() ![]() ![]() ![]() ![]() |
![]() |
I |
X0Y
|
B | 100.0 /100.0 |
2 /3 |
R1AB_SARS2 Non-structural protein 9 |
![]() ![]() ![]() ![]() ![]() |
![]() |
I |
X0Y
|
B | 100.0 /100.0 |
2 /3 |
R1AB_SARS2 Non-structural protein 9 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
L |
X0Y
|
C | 100.0 /100.0 |
6 /6 |
R1AB_SARS2 Non-structural protein 9 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
L |
X0Y
|
C | 100.0 /100.0 |
6 /6 |
R1AB_SARS2 Non-structural protein 9 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
M |
X0Y
|
C | 100.0 /100.0 |
3 /4 |
R1AB_SARS2 Non-structural protein 9 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
M |
X0Y
|
C | 100.0 /100.0 |
3 /4 |
R1AB_SARS2 Non-structural protein 9 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
I |
ODN
|
A | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Non-structural protein 9 |
![]() ![]() ![]() ![]() |
![]() |
J |
ODN
|
A | 100.0 /100.0 |
2 /3 |
R1AB_SARS2 Non-structural protein 9 |
![]() ![]() ![]() ![]() |
![]() |
I |
ODN
|
B | 100.0 /100.0 |
2 /3 |
R1AB_SARS2 Non-structural protein 9 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
J |
ODN
|
B | 100.0 /100.0 |
7 /7 |
R1AB_SARS2 Non-structural protein 9 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
L |
ODN
|
C | 100.0 /100.0 |
6 /6 |
R1AB_SARS2 Non-structural protein 9 |
![]() ![]() ![]() |
![]() |
M |
ODN
|
C | 100.0 /100.0 |
1 /2 |
R1AB_SARS2 Non-structural protein 9 |
![]() ![]() ![]() ![]() |
![]() |
L |
ODN
|
D | 100.0 /100.0 |
3 /4 |
R1AB_SARS2 Non-structural protein 9 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
M |
ODN
|
D | 100.0 /100.0 |
6 /6 |
R1AB_SARS2 Non-structural protein 9 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
O |
ODN
|
E | 100.0 /100.0 |
7 /7 |
R1AB_SARS2 Non-structural protein 9 |
![]() ![]() ![]() ![]() |
![]() |
P |
ODN
|
E | 100.0 /100.0 |
2 /3 |
R1AB_SARS2 Non-structural protein 9 |
![]() ![]() ![]() ![]() ![]() |
![]() |
O |
ODN
|
F | 100.0 /100.0 |
2 /3 |
R1AB_SARS2 Non-structural protein 9 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
P |
ODN
|
F | 100.0 /100.0 |
7 /7 |
R1AB_SARS2 Non-structural protein 9 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
R |
ODN
|
G | 100.0 /100.0 |
7 /7 |
R1AB_SARS2 Non-structural protein 9 |
![]() ![]() ![]() ![]() ![]() |
![]() |
T |
ODN
|
G | 100.0 /100.0 |
2 /3 |
R1AB_SARS2 Non-structural protein 9 |
![]() ![]() ![]() ![]() ![]() |
![]() |
R |
ODN
|
H | 100.0 /100.0 |
2 /3 |
R1AB_SARS2 Non-structural protein 9 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
T |
ODN
|
H | 100.0 /100.0 |
6 /6 |
R1AB_SARS2 Non-structural protein 9 |
![]() ![]() |
![]() |
T |
U5P
|
I | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Non-structural protein 9 |
![]() ![]() |
![]() |
S |
U5P
|
I | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Non-structural protein 9 |
![]() ![]() |
![]() |
L |
GTP
|
I | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Non-structural protein 9 |
![]() ![]() |
![]() |
L |
GTP
|
I | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Non-structural protein 9 |
![]() ![]() |
![]() |
L |
GTP
|
I | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Non-structural protein 9 |
![]() ![]() |
![]() |
T |
F86
|
I | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Non-structural protein 9 |
![]() ![]() |
![]() |
S |
6GS
|
G | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Non-structural protein 9 |
![]() ![]() ![]() |
![]() |
O |
WSB
|
E | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Non-structural protein 9 |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
![]() |
|||||||
113 | pdb_id | contact mol | homologue | ||||
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
a3 | description | a4 | identity[%]5 | Ncon6 | description | |
![]() ![]() |
![]() |
M |
MG
|
I | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Non-structural protein 9 |
![]() ![]() ![]() |
![]() |
N |
MG
|
E | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Non-structural protein 9 |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
![]() |
|||||||
113 | pdb_id | contact mol | homologue | ||||
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
a3 | description | a4 | identity[%]5 | Ncon6 | description | |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | R1AB_SARS2 Non-structural protein 9[116 aa] | A | 100.0 /100.0 |
16 /16 |
R1AB_SARS2 Non-structural protein 9 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | R1AB_SARS2 Non-structural protein 9[109 aa] | B | 100.0 /100.0 |
17 /18 |
R1AB_SARS2 Non-structural protein 9 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | R1AB_SARS2 3C-like proteinase peptide, Non-structural protein.. | A | 100.0 /100.0 |
20 /24 |
R1AB_SARS2 3C-like proteinase peptide, Non-structural protein.. |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | R1AB_SARS2 3C-like proteinase peptide, Non-structural protein.. | A | 100.0 /100.0 |
20 /24 |
R1AB_SARS2 3C-like proteinase peptide, Non-structural protein.. |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | SARS-coV-2 Non-structural protein 9[111 aa] | A | 100.0 /100.0 |
18 /18 |
SARS-coV-2 Non-structural protein 9 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | SARS-coV-2 Non-structural protein 9[112 aa] | B | 100.0 /100.0 |
22 /22 |
SARS-coV-2 Non-structural protein 9 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | R1AB_SARS2 Non-structural protein 9[110 aa] | A | 100.0 /100.0 |
18 /18 |
R1AB_SARS2 Non-structural protein 9 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | R1AB_SARS2 Non-structural protein 9[113 aa] | B | 100.0 /100.0 |
19 /19 |
R1AB_SARS2 Non-structural protein 9 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | Nsp9[108 aa] | A | 100.0 /100.0 |
13 /13 |
Nsp9 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | Nsp9[108 aa] | B | 100.0 /100.0 |
11 /11 |
Nsp9 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
D | Nsp9[106 aa] | C | 100.0 /100.0 |
10 /10 |
Nsp9 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | Nsp9[107 aa] | D | 100.0 /100.0 |
10 /10 |
Nsp9 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
F | Nsp9[108 aa] | E | 100.0 /100.0 |
12 /12 |
Nsp9 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
E | Nsp9[108 aa] | F | 100.0 /100.0 |
13 /13 |
Nsp9 |
![]() ![]() ![]() |
![]() |
B | R1AB_SARS2 Non-structural protein 9[127 aa] | A | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Non-structural protein 9 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | R1AB_SARS2 Non-structural protein 9[127 aa] | A | 100.0 /100.0 |
19 /22 |
R1AB_SARS2 Non-structural protein 9 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | R1AB_SARS2 Non-structural protein 9[127 aa] | A | 100.0 /100.0 |
19 /22 |
R1AB_SARS2 Non-structural protein 9 |
![]() ![]() ![]() |
![]() |
B | R1AB_SARS2 Non-structural protein 9[127 aa] | A | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Non-structural protein 9 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | R1AB_SARS2 Non-structural protein 9[123 aa] | A | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Non-structural protein 9 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | R1AB_SARS2 Non-structural protein 9[123 aa] | A | 100.0 /100.0 |
15 /18 |
R1AB_SARS2 Non-structural protein 9 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | R1AB_SARS2 Non-structural protein 9[123 aa] | A | 100.0 /100.0 |
15 /18 |
R1AB_SARS2 Non-structural protein 9 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | R1AB_SARS2 Non-structural protein 9[123 aa] | A | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Non-structural protein 9 |
![]() ![]() ![]() ![]() ![]() |
![]() |
A | R1AB_SARS2 Non-structural protein 9[127 aa] | B | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Non-structural protein 9 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | R1AB_SARS2 Non-structural protein 9[127 aa] | B | 100.0 /100.0 |
19 /22 |
R1AB_SARS2 Non-structural protein 9 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | R1AB_SARS2 Non-structural protein 9[127 aa] | B | 100.0 /100.0 |
19 /22 |
R1AB_SARS2 Non-structural protein 9 |
![]() ![]() ![]() ![]() ![]() |
![]() |
A | R1AB_SARS2 Non-structural protein 9[127 aa] | B | 100.0 /100.0 |
2 /2 |
R1AB_SARS2 Non-structural protein 9 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | R1AB_SARS2 Non-structural protein 9[127 aa] | B | 100.0 /100.0 |
11 /14 |
R1AB_SARS2 Non-structural protein 9 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | R1AB_SARS2 Non-structural protein 9[127 aa] | B | 100.0 /100.0 |
11 /14 |
R1AB_SARS2 Non-structural protein 9 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | R1AB_SARS2 Non-structural protein 9[123 aa] | B | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Non-structural protein 9 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | R1AB_SARS2 Non-structural protein 9[123 aa] | B | 100.0 /100.0 |
5 /5 |
R1AB_SARS2 Non-structural protein 9 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | R1AB_SARS2 Non-structural protein 9[127 aa] | C | 100.0 /100.0 |
7 /7 |
R1AB_SARS2 Non-structural protein 9 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | R1AB_SARS2 Non-structural protein 9[127 aa] | C | 100.0 /100.0 |
19 /22 |
R1AB_SARS2 Non-structural protein 9 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | R1AB_SARS2 Non-structural protein 9[127 aa] | C | 100.0 /100.0 |
19 /22 |
R1AB_SARS2 Non-structural protein 9 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | R1AB_SARS2 Non-structural protein 9[127 aa] | C | 100.0 /100.0 |
7 /7 |
R1AB_SARS2 Non-structural protein 9 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | R1AB_SARS2 Non-structural protein 9[127 aa] | C | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Non-structural protein 9 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | R1AB_SARS2 Non-structural protein 9[127 aa] | C | 100.0 /100.0 |
4 /4 |
R1AB_SARS2 Non-structural protein 9 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | R1AB_SARS2 Non-structural protein 9[123 aa] | C | 100.0 /100.0 |
20 /23 |
R1AB_SARS2 Non-structural protein 9 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | R1AB_SARS2 Non-structural protein 9[123 aa] | C | 100.0 /100.0 |
20 /23 |
R1AB_SARS2 Non-structural protein 9 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
B | R1AB_SARS2 Non-structural protein 9[124 aa] | A | 100.0 /100.0 |
21 /24 |
R1AB_SARS2 Non-structural protein 9 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
A | R1AB_SARS2 Non-structural protein 9[124 aa] | B | 100.0 /100.0 |
19 /22 |
R1AB_SARS2 Non-structural protein 9 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
D | R1AB_SARS2 Non-structural protein 9[124 aa] | C | 100.0 /100.0 |
20 /22 |
R1AB_SARS2 Non-structural protein 9 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | R1AB_SARS2 Non-structural protein 9[124 aa] | D | 100.0 /100.0 |
18 /20 |
R1AB_SARS2 Non-structural protein 9 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
F | R1AB_SARS2 Non-structural protein 9[124 aa] | E | 100.0 /100.0 |
21 /24 |
R1AB_SARS2 Non-structural protein 9 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
E | R1AB_SARS2 Non-structural protein 9[124 aa] | F | 100.0 /100.0 |
19 /23 |
R1AB_SARS2 Non-structural protein 9 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
H | R1AB_SARS2 Non-structural protein 9[124 aa] | G | 100.0 /100.0 |
20 /22 |
R1AB_SARS2 Non-structural protein 9 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
G | R1AB_SARS2 Non-structural protein 9[121 aa] | H | 100.0 /100.0 |
17 /20 |
R1AB_SARS2 Non-structural protein 9 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
D | R1AB_SARS2 Non-structural protein 9[74 aa] | C | 100.0 /100.0 |
26 /26 |
R1AB_SARS2 Non-structural protein 9 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
D | R1AB_SARS2 Non-structural protein 9[74 aa] | C | 100.0 /100.0 |
26 /26 |
R1AB_SARS2 Non-structural protein 9 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
D | R1AB_SARS2 Non-structural protein 9[74 aa] | C | 100.0 /100.0 |
26 /26 |
R1AB_SARS2 Non-structural protein 9 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
D | R1AB_SARS2 Non-structural protein 9[74 aa] | C | 100.0 /100.0 |
26 /26 |
R1AB_SARS2 Non-structural protein 9 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
D | R1AB_SARS2 Non-structural protein 9[74 aa] | C | 100.0 /100.0 |
26 /26 |
R1AB_SARS2 Non-structural protein 9 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
D | R1AB_SARS2 Non-structural protein 9[74 aa] | C | 100.0 /100.0 |
26 /26 |
R1AB_SARS2 Non-structural protein 9 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | R1AB_SARS2 Non-structural protein 9[78 aa] | D | 100.0 /100.0 |
24 /24 |
R1AB_SARS2 Non-structural protein 9 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | R1AB_SARS2 Non-structural protein 9[78 aa] | D | 100.0 /100.0 |
24 /24 |
R1AB_SARS2 Non-structural protein 9 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | R1AB_SARS2 Non-structural protein 9[78 aa] | D | 100.0 /100.0 |
24 /24 |
R1AB_SARS2 Non-structural protein 9 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | R1AB_SARS2 Non-structural protein 9[78 aa] | D | 100.0 /100.0 |
24 /24 |
R1AB_SARS2 Non-structural protein 9 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | R1AB_SARS2 Non-structural protein 9[78 aa] | D | 100.0 /100.0 |
24 /24 |
R1AB_SARS2 Non-structural protein 9 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C | R1AB_SARS2 Non-structural protein 9[78 aa] | D | 100.0 /100.0 |
24 /24 |
R1AB_SARS2 Non-structural protein 9 |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
![]() |
|||||||
113 | pdb_id | contact mol | homologue | ||||
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
a3 | description | a4 | identity[%]5 | Ncon6 | description | |
![]() ![]() |
![]() |
B |
PO4
|
A | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 3C-like proteinase peptide, Non-structural protein.. |
![]() ![]() |
![]() |
B |
PO4
|
A | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 3C-like proteinase peptide, Non-structural protein.. |
![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
C |
SO4
|
A | 100.0 /100.0 |
2 /2 |
SARS-coV-2 Non-structural protein 9 |
![]() ![]() ![]() |
![]() |
C |
SO4
|
A | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Non-structural protein 9 |
![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
D |
SO4
|
B | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 9 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
E |
SO4
|
B | 100.0 /100.0 |
7 /7 |
R1AB_SARS2 Non-structural protein 9 |
![]() ![]() ![]() ![]() |
![]() |
G |
SO4
|
A | 100.0 /100.0 |
3 /3 |
Nsp9 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
H |
SO4
|
A | 100.0 /100.0 |
5 /5 |
Nsp9 |
![]() ![]() ![]() ![]() ![]() |
![]() |
G |
SO4
|
B | 100.0 /100.0 |
1 /1 |
Nsp9 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
I |
SO4
|
B | 100.0 /100.0 |
4 /4 |
Nsp9 |
![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
J |
SO4
|
C | 100.0 /100.0 |
4 /4 |
Nsp9 |
![]() ![]() ![]() ![]() ![]() ![]() |
![]() |
K |
SO4
|
E | 100.0 /100.0 |
2 /2 |
Nsp9 |
![]() ![]() ![]() ![]() |
![]() |
K |
SO4
|
F | 100.0 /100.0 |
2 /2 |
Nsp9 |
![]() ![]() ![]() |
![]() |
D |
SO4
|
A | 100.0 /100.0 |
2 /3 |
R1AB_SARS2 Non-structural protein 9 |
![]() ![]() ![]() |
![]() |
D |
SO4
|
A | 100.0 /100.0 |
2 /3 |
R1AB_SARS2 Non-structural protein 9 |
![]() ![]() ![]() |
![]() |
G |
SO4
|
B | 100.0 /100.0 |
2 /3 |
R1AB_SARS2 Non-structural protein 9 |
![]() ![]() ![]() |
![]() |
G |
SO4
|
B | 100.0 /100.0 |
2 /3 |
R1AB_SARS2 Non-structural protein 9 |
![]() ![]() ![]() |
![]() |
J |
SO4
|
C | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Non-structural protein 9 |
![]() ![]() ![]() |
![]() |
J |
SO4
|
C | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Non-structural protein 9 |
![]() ![]() ![]() |
![]() |
K |
SO4
|
A | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Non-structural protein 9 |
![]() ![]() ![]() |
![]() |
K |
SO4
|
B | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 9 |
![]() ![]() ![]() |
![]() |
N |
SO4
|
C | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Non-structural protein 9 |
![]() ![]() ![]() |
![]() |
N |
SO4
|
D | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 9 |
![]() ![]() ![]() |
![]() |
Q |
SO4
|
E | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Non-structural protein 9 |
![]() ![]() ![]() |
![]() |
Q |
SO4
|
F | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 9 |
![]() ![]() ![]() |
![]() |
S |
SO4
|
G | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 9 |
![]() ![]() ![]() |
![]() |
S |
SO4
|
H | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Non-structural protein 9 |
![]() ![]() ![]() |
![]() |
K |
MLI
|
A | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 9 |
![]() ![]() ![]() |
![]() |
K |
MLI
|
A | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 9 |
![]() ![]() ![]() |
![]() |
K |
MLI
|
B | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Non-structural protein 9 |
![]() ![]() ![]() |
![]() |
K |
MLI
|
B | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Non-structural protein 9 |
![]() ![]() ![]() |
![]() |
K |
MLI
|
C | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 9 |
![]() ![]() ![]() |
![]() |
K |
MLI
|
C | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Non-structural protein 9 |
![]() ![]() ![]() |
![]() |
K |
MLI
|
C | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Non-structural protein 9 |
![]() ![]() ![]() |
![]() |
K |
MLI
|
C | 100.0 /100.0 |
3 /3 |
R1AB_SARS2 Non-structural protein 9 |
![]() ![]() ![]() |
![]() |
I |
POP
|
E | 100.0 /100.0 |
1 /1 |
R1AB_SARS2 Non-structural protein 9 |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. |