[Multiple Alignment(many alignments)] [Alignment Bar(many alignments)] [show plain BLAST file]
PSIBLAST 2.11.0+


Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Stephen F.
Altschul, John C. Wootton, E. Michael Gertz, Richa Agarwala,
Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005)
"Protein database searches using compositionally adjusted
substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: uniprot_sprot.fasta
           571,282 sequences; 206,678,396 total letters

Results from round 1


Query= sp|P59636|ORF9B_SARS ORF9b protein OS=Severe acute respiratory
syndrome coronavirus OX=694009 GN=9b PE=1 SV=1

Length=98
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

sp|P59636|ORF9B_SARS ORF9b protein OS=Severe acute respiratory sy...  199     3e-67
sp|P0C5A6|ORF9B_BC279 Protein 9b OS=Bat coronavirus 279/2005 OX=3...  171     3e-56
sp|Q3LZX3|ORF9B_BCHK3 Protein 9b OS=Bat coronavirus HKU3 OX=44273...  171     4e-56
sp|Q3I5I6|ORF9B_BCRP3 Protein 9b OS=Bat coronavirus Rp3/2004 OX=3...  165     1e-53
sp|P0DTD2|ORF9B_SARS2 ORF9b protein OS=Severe acute respiratory s...  139     2e-43
sp|A0A0C1EFK1|OPAE_ASPUT Epimerase opaE OS=Aspergillus ustus OX=4...  33.5    0.15 
sp|B5E9Y1|CH10_CITBB Co-chaperonin GroES OS=Citrifermentans bemid...  30.8    0.84 
sp|C6DY42|CH10_GEOSM Co-chaperonin GroES OS=Geobacter sp. (strain...  30.4    1.1  
sp|B6HN77|SORB_PENRW Non-reducing polyketide synthase sorB OS=Pen...  28.5    9.5  


>sp|P59636|ORF9B_SARS ORF9b protein OS=Severe acute respiratory
syndrome coronavirus OX=694009 GN=9b PE=1 SV=1 Length=98 Score = 199 bits (506), Expect = 3e-67, Method: Compositional matrix adjust. Identities = 98/98 (100%), Positives = 98/98 (100%), Gaps = 0/98 (0%) Query 1 MDPNQTNVVPPALHLVDPQIQLTITRMEDAMGQGQNSADPKVYPIILRLGSQLSLSMARR 60 MDPNQTNVVPPALHLVDPQIQLTITRMEDAMGQGQNSADPKVYPIILRLGSQLSLSMARR Sbjct 1 MDPNQTNVVPPALHLVDPQIQLTITRMEDAMGQGQNSADPKVYPIILRLGSQLSLSMARR 60 Query 61 NLDSLEARAFQSTPIVVQMTKLATTEELPDEFVVVTAK 98 NLDSLEARAFQSTPIVVQMTKLATTEELPDEFVVVTAK Sbjct 61 NLDSLEARAFQSTPIVVQMTKLATTEELPDEFVVVTAK 98
>sp|P0C5A6|ORF9B_BC279 Protein 9b OS=Bat coronavirus 279/2005
OX=389167 GN=9b PE=3 SV=1 Length=97 Score = 171 bits (434), Expect = 3e-56, Method: Compositional matrix adjust. Identities = 87/98 (89%), Positives = 93/98 (95%), Gaps = 1/98 (1%) Query 1 MDPNQTNVVPPALHLVDPQIQLTITRMEDAMGQGQNSADPKVYPIILRLGSQLSLSMARR 60 MDP +T+VVPPALHLVDPQIQLTI RMEDA+ GQ++A PKVYPIILRLGSQLSLSMARR Sbjct 1 MDP-KTSVVPPALHLVDPQIQLTIIRMEDAVVHGQSNAVPKVYPIILRLGSQLSLSMARR 59 Query 61 NLDSLEARAFQSTPIVVQMTKLATTEELPDEFVVVTAK 98 NLDSLEARAFQSTPIVV+MTKLATTEELPDEFVVVTAK Sbjct 60 NLDSLEARAFQSTPIVVKMTKLATTEELPDEFVVVTAK 97
>sp|Q3LZX3|ORF9B_BCHK3 Protein 9b OS=Bat coronavirus HKU3 OX=442736
GN=9b PE=3 SV=1 Length=97 Score = 171 bits (433), Expect = 4e-56, Method: Compositional matrix adjust. Identities = 86/98 (88%), Positives = 92/98 (94%), Gaps = 1/98 (1%) Query 1 MDPNQTNVVPPALHLVDPQIQLTITRMEDAMGQGQNSADPKVYPIILRLGSQLSLSMARR 60 MDP + NVVPPALHLVDPQIQ+TITRMEDA+ QN+A PKVYPIILRLGSQLSLSMA+R Sbjct 1 MDP-KVNVVPPALHLVDPQIQMTITRMEDAVVHDQNNAGPKVYPIILRLGSQLSLSMAKR 59 Query 61 NLDSLEARAFQSTPIVVQMTKLATTEELPDEFVVVTAK 98 NLDSLEARAFQSTPIVV+MTKLATTEELPDEFVVVTAK Sbjct 60 NLDSLEARAFQSTPIVVKMTKLATTEELPDEFVVVTAK 97
>sp|Q3I5I6|ORF9B_BCRP3 Protein 9b OS=Bat coronavirus Rp3/2004
OX=349344 GN=9b PE=3 SV=1 Length=97 Score = 165 bits (418), Expect = 1e-53, Method: Compositional matrix adjust. Identities = 84/98 (86%), Positives = 89/98 (91%), Gaps = 1/98 (1%) Query 1 MDPNQTNVVPPALHLVDPQIQLTITRMEDAMGQGQNSADPKVYPIILRLGSQLSLSMARR 60 MDP +T+VV PALHLVDPQIQLT TRMEDA+ GQN+AD KVYPIILRLGSQLSLSM RR Sbjct 1 MDP-KTSVVLPALHLVDPQIQLTTTRMEDAVVHGQNNADLKVYPIILRLGSQLSLSMVRR 59 Query 61 NLDSLEARAFQSTPIVVQMTKLATTEELPDEFVVVTAK 98 NLDSLE R FQSTPIVV+MTKLATTEELPDEFVVVTAK Sbjct 60 NLDSLEVRVFQSTPIVVKMTKLATTEELPDEFVVVTAK 97
>sp|P0DTD2|ORF9B_SARS2 ORF9b protein OS=Severe acute respiratory
syndrome coronavirus 2 OX=2697049 GN=9b PE=1 SV=1 Length=97 Score = 139 bits (350), Expect = 2e-43, Method: Compositional matrix adjust. Identities = 71/98 (72%), Positives = 83/98 (85%), Gaps = 1/98 (1%) Query 1 MDPNQTNVVPPALHLVDPQIQLTITRMEDAMGQGQNSADPKVYPIILRLGSQLSLSMARR 60 MDP + + + PAL LVDPQIQL +TRME+A+G+ QN+ PKVYPIILRLGS LSL+MAR+ Sbjct 1 MDP-KISEMHPALRLVDPQIQLAVTRMENAVGRDQNNVGPKVYPIILRLGSPLSLNMARK 59 Query 61 NLDSLEARAFQSTPIVVQMTKLATTEELPDEFVVVTAK 98 L+SLE +AFQ TPI VQMTKLATTEELPDEFVVVT K Sbjct 60 TLNSLEDKAFQLTPIAVQMTKLATTEELPDEFVVVTVK 97
>sp|A0A0C1EFK1|OPAE_ASPUT Epimerase opaE OS=Aspergillus ustus
OX=40382 GN=opaE PE=1 SV=1 Length=274 Score = 33.5 bits (75), Expect = 0.15, Method: Compositional matrix adjust. Identities = 24/91 (26%), Positives = 44/91 (48%), Gaps = 6/91 (7%) Query 8 VVPPALHLVDPQIQLTITRMEDAMGQGQNSADPKVYPIILRLGSQLSLSMARRNLDSLEA 67 VV L+ DP +TIT + + +G Q A P + P++ ++ L + N D L Sbjct 29 VVETVLNHKDPSTHVTITSLANRIGGNQTLAYPSIRPLLYGEMIRVCLQARKENYDVLII 88 Query 68 RAFQSTPIVVQMTKLATTEELPDEFVVVTAK 98 F P+V ++ ++A D+ V++ A+ Sbjct 89 NCF-GDPMVDELQQIAG-----DDMVILGAR 113
>sp|B5E9Y1|CH10_CITBB Co-chaperonin GroES OS=Citrifermentans bemidjiense
(strain ATCC BAA-1014 / DSM 16622 / JCM 12645 / Bem) OX=404380 GN=groES PE=3 SV=1 Length=96 Score = 30.8 bits (68), Expect = 0.84, Method: Compositional matrix adjust. Identities = 14/41 (34%), Positives = 21/41 (51%), Gaps = 0/41 (0%) Query 30 AMGQGQNSADPKVYPIILRLGSQLSLSMARRNLDSLEARAF 70 A+G G+ D KVYPI L++G ++ + LE F Sbjct 42 AVGNGKRGEDGKVYPIDLKVGDKVLFGKYAGSEVKLEGEDF 82
>sp|C6DY42|CH10_GEOSM Co-chaperonin GroES OS=Geobacter sp. (strain
M21) OX=443144 GN=groES PE=3 SV=1 Length=96 Score = 30.4 bits (67), Expect = 1.1, Method: Compositional matrix adjust. Identities = 14/41 (34%), Positives = 21/41 (51%), Gaps = 0/41 (0%) Query 30 AMGQGQNSADPKVYPIILRLGSQLSLSMARRNLDSLEARAF 70 A+G G+ D KVYPI L++G ++ + LE F Sbjct 42 AVGNGKRGDDGKVYPIDLKVGDKVLFGKYAGSEVKLEGEDF 82
>sp|B6HN77|SORB_PENRW Non-reducing polyketide synthase sorB OS=Penicillium
rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) OX=500485 GN=sorB PE=3 SV=1 Length=2664 Score = 28.5 bits (62), Expect = 9.5, Method: Compositional matrix adjust. Identities = 13/36 (36%), Positives = 21/36 (58%), Gaps = 0/36 (0%) Query 23 TITRMEDAMGQGQNSADPKVYPIILRLGSQLSLSMA 58 +IT +E+ + + A P V P+IL G Q+S S+ Sbjct 936 SITELEEKLASFETFAVPSVRPVILCFGGQVSKSVG 971 Lambda K H a alpha 0.316 0.130 0.355 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 5220477562 Results from round 2 Query= sp|P59636|ORF9B_SARS ORF9b protein OS=Severe acute respiratory syndrome coronavirus OX=694009 GN=9b PE=1 SV=1 Length=98 Score E Sequences producing significant alignments: (Bits) Value Sequences used in model and found again: sp|P59636|ORF9B_SARS ORF9b protein OS=Severe acute respiratory sy... 161 3e-52 sp|Q3LZX3|ORF9B_BCHK3 Protein 9b OS=Bat coronavirus HKU3 OX=44273... 157 1e-50 sp|P0C5A6|ORF9B_BC279 Protein 9b OS=Bat coronavirus 279/2005 OX=3... 154 2e-49 sp|Q3I5I6|ORF9B_BCRP3 Protein 9b OS=Bat coronavirus Rp3/2004 OX=3... 151 3e-48 sp|P0DTD2|ORF9B_SARS2 ORF9b protein OS=Severe acute respiratory s... 147 1e-46 Sequences not found previously or not previously below threshold: sp|A0A0C1EFK1|OPAE_ASPUT Epimerase opaE OS=Aspergillus ustus OX=4... 32.4 0.37 sp|Q98IH6|ADC2_RHILO Acetoacetate decarboxylase 2 OS=Mesorhizobiu... 32.4 0.37 sp|Q98AN6|ADC1_RHILO Acetoacetate decarboxylase 1 OS=Mesorhizobiu... 31.6 0.83 sp|Q7NSA6|ADC_CHRVO Acetoacetate decarboxylase OS=Chromobacterium... 30.4 1.8 sp|A4JKF7|ADC_BURVG Acetoacetate decarboxylase OS=Burkholderia vi... 28.9 7.0
>sp|P59636|ORF9B_SARS ORF9b protein OS=Severe acute respiratory
syndrome coronavirus OX=694009 GN=9b PE=1 SV=1 Length=98 Score = 161 bits (408), Expect = 3e-52, Method: Composition-based stats. Identities = 98/98 (100%), Positives = 98/98 (100%), Gaps = 0/98 (0%) Query 1 MDPNQTNVVPPALHLVDPQIQLTITRMEDAMGQGQNSADPKVYPIILRLGSQLSLSMARR 60 MDPNQTNVVPPALHLVDPQIQLTITRMEDAMGQGQNSADPKVYPIILRLGSQLSLSMARR Sbjct 1 MDPNQTNVVPPALHLVDPQIQLTITRMEDAMGQGQNSADPKVYPIILRLGSQLSLSMARR 60 Query 61 NLDSLEARAFQSTPIVVQMTKLATTEELPDEFVVVTAK 98 NLDSLEARAFQSTPIVVQMTKLATTEELPDEFVVVTAK Sbjct 61 NLDSLEARAFQSTPIVVQMTKLATTEELPDEFVVVTAK 98
>sp|Q3LZX3|ORF9B_BCHK3 Protein 9b OS=Bat coronavirus HKU3 OX=442736
GN=9b PE=3 SV=1 Length=97 Score = 157 bits (397), Expect = 1e-50, Method: Composition-based stats. Identities = 86/98 (88%), Positives = 92/98 (94%), Gaps = 1/98 (1%) Query 1 MDPNQTNVVPPALHLVDPQIQLTITRMEDAMGQGQNSADPKVYPIILRLGSQLSLSMARR 60 MDP + NVVPPALHLVDPQIQ+TITRMEDA+ QN+A PKVYPIILRLGSQLSLSMA+R Sbjct 1 MDP-KVNVVPPALHLVDPQIQMTITRMEDAVVHDQNNAGPKVYPIILRLGSQLSLSMAKR 59 Query 61 NLDSLEARAFQSTPIVVQMTKLATTEELPDEFVVVTAK 98 NLDSLEARAFQSTPIVV+MTKLATTEELPDEFVVVTAK Sbjct 60 NLDSLEARAFQSTPIVVKMTKLATTEELPDEFVVVTAK 97
>sp|P0C5A6|ORF9B_BC279 Protein 9b OS=Bat coronavirus 279/2005
OX=389167 GN=9b PE=3 SV=1 Length=97 Score = 154 bits (389), Expect = 2e-49, Method: Composition-based stats. Identities = 87/98 (89%), Positives = 93/98 (95%), Gaps = 1/98 (1%) Query 1 MDPNQTNVVPPALHLVDPQIQLTITRMEDAMGQGQNSADPKVYPIILRLGSQLSLSMARR 60 MDP +T+VVPPALHLVDPQIQLTI RMEDA+ GQ++A PKVYPIILRLGSQLSLSMARR Sbjct 1 MDP-KTSVVPPALHLVDPQIQLTIIRMEDAVVHGQSNAVPKVYPIILRLGSQLSLSMARR 59 Query 61 NLDSLEARAFQSTPIVVQMTKLATTEELPDEFVVVTAK 98 NLDSLEARAFQSTPIVV+MTKLATTEELPDEFVVVTAK Sbjct 60 NLDSLEARAFQSTPIVVKMTKLATTEELPDEFVVVTAK 97
>sp|Q3I5I6|ORF9B_BCRP3 Protein 9b OS=Bat coronavirus Rp3/2004
OX=349344 GN=9b PE=3 SV=1 Length=97 Score = 151 bits (382), Expect = 3e-48, Method: Composition-based stats. Identities = 84/98 (86%), Positives = 89/98 (91%), Gaps = 1/98 (1%) Query 1 MDPNQTNVVPPALHLVDPQIQLTITRMEDAMGQGQNSADPKVYPIILRLGSQLSLSMARR 60 MDP +T+VV PALHLVDPQIQLT TRMEDA+ GQN+AD KVYPIILRLGSQLSLSM RR Sbjct 1 MDP-KTSVVLPALHLVDPQIQLTTTRMEDAVVHGQNNADLKVYPIILRLGSQLSLSMVRR 59 Query 61 NLDSLEARAFQSTPIVVQMTKLATTEELPDEFVVVTAK 98 NLDSLE R FQSTPIVV+MTKLATTEELPDEFVVVTAK Sbjct 60 NLDSLEVRVFQSTPIVVKMTKLATTEELPDEFVVVTAK 97
>sp|P0DTD2|ORF9B_SARS2 ORF9b protein OS=Severe acute respiratory
syndrome coronavirus 2 OX=2697049 GN=9b PE=1 SV=1 Length=97 Score = 147 bits (371), Expect = 1e-46, Method: Composition-based stats. Identities = 71/98 (72%), Positives = 83/98 (85%), Gaps = 1/98 (1%) Query 1 MDPNQTNVVPPALHLVDPQIQLTITRMEDAMGQGQNSADPKVYPIILRLGSQLSLSMARR 60 MDP + + + PAL LVDPQIQL +TRME+A+G+ QN+ PKVYPIILRLGS LSL+MAR+ Sbjct 1 MDP-KISEMHPALRLVDPQIQLAVTRMENAVGRDQNNVGPKVYPIILRLGSPLSLNMARK 59 Query 61 NLDSLEARAFQSTPIVVQMTKLATTEELPDEFVVVTAK 98 L+SLE +AFQ TPI VQMTKLATTEELPDEFVVVT K Sbjct 60 TLNSLEDKAFQLTPIAVQMTKLATTEELPDEFVVVTVK 97
>sp|A0A0C1EFK1|OPAE_ASPUT Epimerase opaE OS=Aspergillus ustus
OX=40382 GN=opaE PE=1 SV=1 Length=274 Score = 32.4 bits (72), Expect = 0.37, Method: Composition-based stats. Identities = 24/91 (26%), Positives = 44/91 (48%), Gaps = 6/91 (7%) Query 8 VVPPALHLVDPQIQLTITRMEDAMGQGQNSADPKVYPIILRLGSQLSLSMARRNLDSLEA 67 VV L+ DP +TIT + + +G Q A P + P++ ++ L + N D L Sbjct 29 VVETVLNHKDPSTHVTITSLANRIGGNQTLAYPSIRPLLYGEMIRVCLQARKENYDVLII 88 Query 68 RAFQSTPIVVQMTKLATTEELPDEFVVVTAK 98 F P+V ++ ++A D+ V++ A+ Sbjct 89 NCF-GDPMVDELQQIAG-----DDMVILGAR 113
>sp|Q98IH6|ADC2_RHILO Acetoacetate decarboxylase 2 OS=Mesorhizobium
japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099) OX=266835 GN=adc2 PE=3 SV=1 Length=261 Score = 32.4 bits (72), Expect = 0.37, Method: Composition-based stats. Identities = 15/48 (31%), Positives = 25/48 (52%), Gaps = 1/48 (2%) Query 2 DPNQT-NVVPPALHLVDPQIQLTITRMEDAMGQGQNSADPKVYPIILR 48 DP + ++VP L L +P ++ RM D+ G G + +V P+ R Sbjct 40 DPKKLRSLVPEPLELSEPLVKFEFIRMPDSTGFGNYTESGQVIPVTFR 87
>sp|Q98AN6|ADC1_RHILO Acetoacetate decarboxylase 1 OS=Mesorhizobium
japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099) OX=266835 GN=adc1 PE=3 SV=1 Length=247 Score = 31.6 bits (70), Expect = 0.83, Method: Composition-based stats. Identities = 13/45 (29%), Positives = 24/45 (53%), Gaps = 1/45 (2%) Query 2 DPNQT-NVVPPALHLVDPQIQLTITRMEDAMGQGQNSADPKVYPI 45 DP + ++VP L + +P ++ RM D+ G G + +V P+ Sbjct 40 DPQKLRDLVPEPLQVCEPMVKFEFIRMPDSTGFGDYTEGGQVIPV 84
>sp|Q7NSA6|ADC_CHRVO Acetoacetate decarboxylase OS=Chromobacterium
violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) OX=243365 GN=adc PE=1 SV=1 Length=246 Score = 30.4 bits (67), Expect = 1.8, Method: Composition-based stats. Identities = 18/58 (31%), Positives = 28/58 (48%), Gaps = 2/58 (3%) Query 2 DPNQTNVVPP-ALHLVDPQIQLTITRMEDAMGQGQNSADPKVYPIILRLGSQLSLSMA 58 DP V P L + +P ++ RM D+ G G S +V P+ R G + S ++A Sbjct 40 DPAAIEAVLPEPLQMAEPVVRYEFIRMPDSTGFGDYSESGQVIPVTFR-GERGSYTLA 96
>sp|A4JKF7|ADC_BURVG Acetoacetate decarboxylase OS=Burkholderia
vietnamiensis (strain G4 / LMG 22486) OX=269482 GN=adc PE=3 SV=1 Length=246 Score = 28.9 bits (63), Expect = 7.0, Method: Composition-based stats. Identities = 14/45 (31%), Positives = 22/45 (49%), Gaps = 1/45 (2%) Query 2 DPNQT-NVVPPALHLVDPQIQLTITRMEDAMGQGQNSADPKVYPI 45 DP + VVP L + +P + RM D+ G G + +V P+ Sbjct 40 DPERLRAVVPEPLQIAEPLVHYEFIRMADSTGFGDYTESGQVIPV 84 Lambda K H a alpha 0.312 0.124 0.339 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0380 0.140 1.90 42.6 43.6 Effective search space used: 5220477562 Search has CONVERGED! Database: uniprot_sprot.fasta Posted date: Apr 3, 2024 12:05 PM Number of letters in database: 206,678,396 Number of sequences in database: 571,282 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40