Contact Molecules for Homologous Proteins | ||||
[Summary Bars] |
[Full Bars] |
|
[Back to Search Page] |
[Back to HOMCOS] |
[Sites by Variants] |
[SupCon3D] |
[help] |
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100] | [show] [download] [help] |
PID | QueryLength | Homolgous Sequence in PDB | UniProt Query | TITLE |
31126 | 468 | 15 | P08887(IL6RA_HUMAN) | RecName: Full=Interleukin-6 receptor subunit alpha ; Short=IL-6 receptor subunit alpha; Short=IL-6R subunit alpha; Short=IL-6R-alpha; Short=IL-6RA;AltName: Full=IL-6R 1;AltName: Full=Membrane glycoprotein 80; Short=gp80;AltName: CD_antigen=CD126;Contains: RecName: Full=Soluble interleukin-6 receptor subunit alpha ; Short=sIL6R ;Flags: Precursor; |
QUERYSEQ |
MLAVGCALLAALLAAPGAALAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLV RKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQ GEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSLPVQDSSSVPLPTFLVAGGSLAFGTLLCIAIVLRFKKTWKLRALKEGKTSMHPPYSLGQLVPERPRPTPVLVPLISPPVSPSSLGSDNTSSHNRPDA RDPRSPYDISNTDYFFPR |
[n]:site number of query sequence. [a]:amino acid of query sequence. [s]:predicted secondary structure. [e]:predicted exposed/buried. [acc]:predicted relative accesssibility(%). [pdb]:PDB code of homologous structure. [contact_mols]:predicted binding molecules [observed aa]:Observed amino acids among homologous sequences. [feature table]:UniProt Feature Table [variant]:UniProt Human Variant.
n | a | s | e | acc | pdb | contact_mols | observed aa | feature table | variant |
1 | M | - | - | - | - | M |
SIGNAL DISORDER predicted by DISOPRED SIGNAL | ||
2 | L | - | - | - | - | LM |
SIGNAL DISORDER predicted by DISOPRED SIGNAL | ||
3 | A | - | - | - | - | SAT |
SIGNAL DISORDER predicted by DISOPRED SIGNAL | ||
4 | V | - | - | - | - | VS |
SIGNAL DISORDER predicted by DISOPRED SIGNAL | ||
5 | G | - | - | - | - | GS |
SIGNAL DISORDER predicted by DISOPRED SIGNAL | ||
6 | C | - | - | - | - | C |
SIGNAL DISORDER predicted by DISOPRED SIGNAL | ||
7 | A | - | - | - | - | SAT |
SIGNAL DISORDER predicted by DISOPRED SIGNAL | ||
8 | L | - | - | - | - | LG |
SIGNAL DISORDER predicted by DISOPRED SIGNAL | ||
9 | L | - | - | - | - | LS |
SIGNAL DISORDER predicted by DISOPRED SIGNAL | ||
10 | A | - | - | - | - | VTLSA |
SIGNAL DISORDER predicted by DISOPRED SIGNAL | ||
11 | A | - | - | - | - | VAR |
SIGNAL DISORDER predicted by DISOPRED SIGNAL | ||
12 | L | - | - | - | - | LVF |
SIGNAL DISORDER predicted by DISOPRED SIGNAL | ||
13 | L | - | - | - | - | L |
SIGNAL DISORDER predicted by DISOPRED SIGNAL | ||
14 | A | - | - | - | - | AVT |
SIGNAL DISORDER predicted by DISOPRED SIGNAL | ||
15 | A | - | - | - | - | AS |
SIGNAL DISORDER predicted by DISOPRED SIGNAL | ||
16 | P | - | - | - | - | PV |
SIGNAL DISORDER predicted by DISOPRED SIGNAL | ||
17 | G | - | - | - | - | ALIG |
SIGNAL DISORDER predicted by DISOPRED SIGNAL | ||
18 | A | - | - | - | - | VMTAL |
SIGNAL DISORDER predicted by DISOPRED SIGNAL | ||
19 | A | - | - | - | - | A |
SIGNAL SIGNAL | ||
20 | L | e | 45.5 | 1n26_A | LIM |
TOPO_DOM /note="Extracellular" TOPO_DOM /note="Extracellular" | |||
21 | A | b | 4.5 | 1n26_A | WVA |
TOPO_DOM /note="Extracellular" TOPO_DOM /note="Extracellular" | |||
22 | P | S | b | 6.2 | 1n26_A | ESLP |
TOPO_DOM /note="Extracellular" TOPO_DOM /note="Extracellular" | ||
23 | R | S | e | 88.1 | 1n26_A | LSGR |
TOPO_DOM /note="Extracellular" TOPO_DOM /note="Extracellular" | ||
24 | R | e | 73.1 | 1n26_A | ESKPGR |
TOPO_DOM /note="Extracellular" TOPO_DOM /note="Extracellular" | |||
25 | C | b | 10.0 | 1n26_A | CK |
DISULFID ECO:0000269|PubMed:10066782" TOPO_DOM /note="Extracellular" DISULFID ECO:0000269|PubMed:10066782" TOPO_DOM /note="Extracellular" | |||
26 | P | e | 42.6 | 1n26_A | PDNRS |
DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" | |||
27 | A | e | 31.2 | 1n26_A | VQAK |
DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" | |||
28 | Q | e | 34.2 | 1n26_A | YALQ |
DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" | |||
29 | E | e | 84.4 | 1n26_A | VEWI |
DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" | |||
30 | V | e | 32.0 | 1n26_A | VG |
DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" | |||
31 | A | e | 65.2 | 1n26_A | EAP |
DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" | |||
32 | R | T | e | 91.7 | 1n26_A | LPNVQR |
DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" | ||
33 | G | T | e | 90.5 | 1n26_A | DG |
DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" | ||
34 | V | E | e | 24.7 | 1n26_A | WVT |
DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" | ||
35 | L | E | e | 41.6 | 1n26_A | YQLVSH |
DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" | ||
36 | T | E | e | 32.5 | 1n26_A | TPY |
DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" | ||
37 | S | E | b | 10.2 | 1n26_A | DSGLN |
DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" | ||
38 | L | e | 37.1 | 1n26_A | LAQ |
DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" | |||
39 | P | T | e | 37.2 | 1n26_A | PILA |
DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" | ||
40 | G | T | e | 47.6 | 1n26_A | G |
DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" | ||
41 | D | e | 45.7 | 1n26_A | EASRD |
DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" | |||
42 | S | e | 61.7 | 1n26_A | TSMPDRK |
DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" | |||
43 | V | E | b | 8.0 | 1n26_A | VL |
DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" | ||
44 | T | E | e | 39.0 | 1n26_A | VTMNQK |
DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" | ||
45 | L | E | b | 0.0 | 1n26_A | LAIM |
DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" | ||
46 | T | E | e | 25.3 | 1n26_A | TCIKR |
DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" | ||
47 | C | b | 0.0 | 1n26_A | C |
DISULFID ECO:0000269|PubMed:10066782" DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" DISULFID ECO:0000269|PubMed:10066782" DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" | |||
48 | P | T | e | 65.1 | 1n26_A | PDNSGH |
DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" | ||
49 | G | T | e | 66.7 | 1n26_A | GTSADEKLPV |
DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" | ||
50 | V | S | b | 1.3 | 1n26_A | VAKSMPGLDEIRTCFHNQY |
DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" | ||
51 | E | e | 64.8 | 1n26_A | ETDSNLAGIKPRVCFHMQY |
DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" | |||
52 | P | T | e | 75.2 | 1n26_A | PAEWGLSVDFHIKMNQRTY |
DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" | ||
53 | E | T | e | 56.3 | 1n26_A | compound NAG | EDGALFIKNPQRSTVY |
DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" | |
54 | D | e | 32.7 | 1n26_A | compound NAG | DEGALFIKNPQRSTVY |
DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" | ||
55 | N | e | 72.1 | 1n26_A | compound NAG | DNGALEKSTVFIPQRYCHMW |
CARBOHYD /note="N-linked (GlcNAc...) asparagine" ECO:0000269|PubMed:28060820" MUTAGEN /note="N->A: Strongly induces cleavage and sIL6R levels. No effect on IL6R signaling; when associated with A-93, A-221, A-245 and A-350. Loss of cleavage by ADAM17; when associated with A-93, A-221, A-245 and A-350." DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" CARBOHYD /note="N-linked (GlcNAc...) asparagine" ECO:0000269|PubMed:28060820" MUTAGEN /note="N->A: Strongly induces cleavage and sIL6R levels. No effect on IL6R signaling; when associated with A-93, A-221, A-245 and A-350. Loss of cleavage by ADAM17; when associated with A-93, A-221, A-245 and A-350." DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" | ||
56 | A | S | e | 22.3 | 1n26_A | AGTVILSDEFKNPQRCHMWY |
DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" | ||
57 | T | E | e | 51.9 | 1n26_A | TPALGSVDEIKRFNQYCHMW |
MUTAGEN /note="T->A: Strongly induces cleavage and sIL6R levels." DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" MUTAGEN /note="T->A: Strongly induces cleavage and sIL6R levels." DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" | ||
58 | V | E | b | 0.0 | 1n26_A | IVLADEGKNPQRST |
DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" | ||
59 | H | E | e | 51.3 | 1n26_A | homo | THSYIADEGKLNPQRV |
DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" | |
60 | W | E | b | 0.8 | 1n26_A | WADEGKLPSTV |
DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" | ||
61 | V | E | b | 3.3 | 1n26_A | TVFLAEGSDIKNPQRCHMWY |
DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" | ||
62 | L | E | b | 2.2 | 1n26_A | LYFRSADEGKTVINPQCHMW |
DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" | ||
63 | R | E | e | 37.2 | 1n26_A | compound NAG otherpoly | RDLNQAGEKPSTVFIYCHMW |
DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" | |
64 | K | e | 25.5 | 1n26_A | otherpoly | KGDENQALPSTVFIRYCHMW |
DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" | ||
65 | P | S | e | 77.5 | 1n26_A | otherpoly | PRGQNSALDEKTVFIYCHMW |
DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" | |
66 | A | S | e | 58.0 | 1n26_A | RADKSVGLEFINPQTCHMWY |
DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" | ||
67 | A | S | e | 92.9 | 1n26_A | TSLQNEAG |
DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" | ||
68 | G | S | e | 101.2 | 1n26_A | GSPRLAV |
DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" | ||
69 | S | e | 32.8 | 1n26_A | SDCLTQAEGIKPRV |
DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" | |||
70 | H | e | 56.5 | 1n26_A | QHEDLGPRAIKSTV |
DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" | |||
71 | P | e | 55.0 | 1n26_A | SLPYIQDNKAEGRTV |
DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" | |||
72 | S | E | e | 21.9 | 1n26_A | SDGRNAEIKLPTV |
DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" | ||
73 | R | E | e | 68.4 | 1n26_A | homo | ERDPAFGIKLNQSTVY |
DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" | |
74 | W | E | e | 41.8 | 1n26_A | homo | VWLRSDPIAEFGKNQTY |
DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" | |
75 | A | E | e | 62.5 | 1n26_A | homo | LASNTVH |
DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" | |
76 | G | E | b | 15.5 | 1n26_A | GKNTL |
DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" | ||
77 | M | E | e | 67.6 | 1n26_A | homo | SLTVNM |
DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" | |
78 | G | S | b | 14.3 | 1n26_A | GISK |
DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" | ||
79 | R | S | e | 24.1 | 1n26_A | KHSLMTNRY |
DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" | ||
80 | R | E | e | 55.3 | 1n26_A | homo | TRYLQVE |
DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" | |
81 | L | E | e | 20.8 | 1n26_A | homo | LYAKV |
DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" | |
82 | L | E | e | 51.7 | 1n26_A | homo | VTLIFQ |
DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" | |
83 | L | E | b | 8.4 | 1n26_A | homo | LIVD |
DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" | |
84 | R | e | 87.7 | 1n26_A | homo | RQAKNLH |
DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" | ||
85 | S | S | e | 41.4 | 1n26_A | VSQAGRCND |
DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" | ||
86 | V | b | 0.0 | 1n26_A | VKRILSA |
DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" | |||
87 | Q | e | 35.7 | 1n26_A | EDQCKNRL |
DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" | |||
88 | L | G | e | 45.5 | 1n26_A | FLSAQMTV |
DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" | ||
89 | H | G | e | 60.2 | 1n26_A | GESHTLQPNRA |
DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" | ||
90 | D | G | b | 19.8 | 1n26_A | homo | DHSQN |
DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" | |
91 | S | b | 13.3 | 1n26_A | ASGEPTI |
DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" | |||
92 | G | E | b | 3.6 | 1n26_A | GDH |
DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" | ||
93 | N | E | e | 35.2 | 1n26_A | compound NAG otherpoly | QENTYLHSDGW |
CARBOHYD /note="N-linked (GlcNAc...) asparagine" ECO:0000269|PubMed:28060820" MUTAGEN /note="N->A: No effect on cleavage or sIL6R levels. No effect on IL6R signaling; when associated with A-55, A-221, A-245 and A-350. Loss of cleavage by ADAM17; when associated with A-55, A-221, A-245 and A-350." DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" CARBOHYD /note="N-linked (GlcNAc...) asparagine" ECO:0000269|PubMed:28060820" MUTAGEN /note="N->A: No effect on cleavage or sIL6R levels. No effect on IL6R signaling; when associated with A-55, A-221, A-245 and A-350. Loss of cleavage by ADAM17; when associated with A-55, A-221, A-245 and A-350." DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" | |
94 | Y | E | b | 0.4 | 1n26_A | YLW |
DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" | ||
95 | S | E | b | 9.4 | 1n26_A | TSVALNI |
DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" | ||
96 | C | E | b | 0.7 | 1n26_A | CES |
DISULFID ECO:0000269|PubMed:10066782" DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" DISULFID ECO:0000269|PubMed:10066782" DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" | ||
97 | Y | E | e | 24.8 | 1n26_A | HRWQFYTS |
DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" | ||
98 | R | S | e | 39.5 | 1n26_A | KTRSHLVEAQ |
DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" | ||
99 | A | S | e | 90.2 | 1n26_A | GSDLTNA |
DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" | ||
100 | G | S | e | 63.1 | 1n26_A | GEWDS |
DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" | ||
101 | R | S | e | 79.4 | 1n26_A | EHRVFSALK |
DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" | ||
102 | P | e | 101.6 | 1n26_A | PVLDITASF |
DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" | |||
103 | A | S | b | 8.9 | 1n26_A | LGVTRAK |
DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" | ||
104 | G | e | 35.7 | 1n26_A | SGIATHCY |
DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" | |||
105 | T | E | e | 30.5 | 1n26_A | TQHGRIMS |
DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" | ||
106 | V | E | b | 13.3 | 1n26_A | VSITM |
DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" | ||
107 | H | E | e | 41.9 | 1n26_A | compound NAG otherpoly | LTERHNCGPYDFQ |
DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" | |
108 | L | E | b | 2.2 | 1n26_A | LIM |
DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" | ||
109 | L | E | e | 24.2 | 1n26_A | LHKIYFRSAQT |
DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" | ||
110 | V | E | b | 2.7 | 1n26_A | VLSIGKT |
DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" | ||
111 | D | b | 0.6 | 1n26_A | GDQEHK |
DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" | |||
112 | V | e | 40.0 | 1n26_A | VILSFYAKQ |
DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" DOMAIN /note="Ig-like C2-type" TOPO_DOM /note="Extracellular" | |||
113 | P | e | 50.4 | 1n26_A | PLDAFVK |
DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" | |||
114 | P | b | 14.0 | 1n26_A | PKQGR |
DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" | |||
115 | E | b | 19.6 | 1n26_A | precipitant | EDKGANR |
DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" | ||
116 | E | e | 39.7 | 1n26_A | precipitant | KQERDPI |
DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" | ||
117 | P | b | 0.0 | 1n26_A | PKTS |
DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" | |||
118 | Q | e | 61.7 | 1n26_A | EKRQNVFGT |
DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" | |||
119 | L | b | 11.8 | 1n26_A | LIVN |
DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" | |||
120 | S | E | e | 47.7 | 1n26_A | SKTIFQMRHV |
DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" | ||
121 | C | E | b | 6.7 | 1n26_A | CKVTR |
MUTAGEN /note="C->S: Complete loss of ligand-binding." DISULFID ECO:0000269|PubMed:10066782" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" MUTAGEN /note="C->S: Complete loss of ligand-binding." DISULFID ECO:0000269|PubMed:10066782" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" | ||
122 | F | E | e | 23.0 | 1n26_A | EICFRVWMADGKLNPQSTY |
MUTAGEN /note="F->A: No change of ligand-binding and IL6 signaling." DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" MUTAGEN /note="F->A: No change of ligand-binding and IL6 signaling." DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" | ||
123 | R | B | b | 1.6 | 1n26_A | ARSQVL |
DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" | ||
124 | K | S | e | 27.8 | 1n26_A | KSNAER |
DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" | ||
125 | S | S | b | 0.8 | 1n26_A | NPTEGDSVCRAL |
DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" | ||
126 | P | T | b | 0.0 | 1n26_A | YEGDPSN |
DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" | ||
127 | L | T | e | 52.2 | 1n26_A | hetero IL6_HUMAN compound NAG | SKAPLYMRNQDEGTV |
DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" | |
128 | S | S | e | 30.5 | 1n26_A | otherpoly | GEKSAIV |
DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" | |
129 | N | e | 35.8 | 1n26_A | otherpoly | NTRGHSDAK |
DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" | ||
130 | V | E | b | 0.0 | 1n26_A | FVMILA |
DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" | ||
131 | V | E | b | 16.7 | 1n26_A | otherpoly | TSAYLDRFGIV |
DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" | |
132 | C | E | b | 0.0 | 1n26_A | CL |
MUTAGEN /note="C->A: Complete loss of ligand-binding." DISULFID ECO:0000269|PubMed:10066782" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" MUTAGEN /note="C->A: Complete loss of ligand-binding." DISULFID ECO:0000269|PubMed:10066782" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" | ||
133 | E | E | e | 20.1 | 1n26_A | WSTEQRA |
DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" | ||
134 | W | E | b | 4.8 | 1n26_A | WL |
MUTAGEN /note="W->L: Complete loss of ligand-binding." DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" MUTAGEN /note="W->L: Complete loss of ligand-binding." DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" | ||
135 | G | e | 40.5 | 1n26_A | GSDTKHIRELNAPV |
DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" | |||
136 | P | b | 10.1 | 1n26_A | PSRTLGFADEIKV |
DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" | |||
137 | R | S | e | 73.9 | 1n26_A | precipitant | GSRTAPDEIKLV |
DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" | |
138 | S | S | e | 60.2 | 1n26_A | SRDAYQPEKTIVGNL |
DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" | ||
139 | T | e | 55.8 | 1n26_A | DLVIPTENHSA |
DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" | |||
140 | P | e | 20.2 | 1n26_A | TGPSQAR |
MUTAGEN /note="P->G: No change of ligand-binding and IL6 signaling." DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" MUTAGEN /note="P->G: No change of ligand-binding and IL6 signaling." DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" | |||
141 | S | e | 27.3 | 1n26_A | GNASYEHD |
DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" | |||
142 | L | T | e | 93.3 | 1n26_A | LSTIVPFH |
DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" | ||
143 | T | T | e | 27.9 | 1n26_A | TPSFEYKG |
DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" | ||
144 | T | b | 7.8 | 1n26_A | TCLNIS |
DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" | |||
145 | K | E | e | 57.1 | 1n26_A | NRGKDHAEPVIT |
DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" | ||
146 | A | E | b | 4.5 | 1n26_A | YATVLGSK |
DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" | ||
147 | V | E | e | 25.3 | 1n26_A | TVAKLSNFE |
DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" | ||
148 | L | E | b | 0.0 | 1n26_A | LFTVISYWM |
DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" | ||
149 | L | E | b | 1.1 | 1n26_A | SLQTHFIAKVY |
DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" | ||
150 | V | E | b | 0.0 | 1n26_A | YLVSAGQTDEIKPR |
DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" | ||
151 | R | E | e | 28.5 | 1n26_A | hetero IL6RB_HUMAN IL6RB_MOUSE | KRSTAHYNDEGILPV |
DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" | |
152 | K | E | b | 16.0 | 1n26_A | KSEGYRADILPTV |
DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" | ||
153 | F | E | e | 42.6 | 1n26_A | hetero IL6RB_MOUSE IL6RB_HUMAN IL6_HUMAN | KPFRSIVEHMAGLDNQTY |
MUTAGEN /note="F->L: No change of ligand-binding and IL6 signaling." DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" MUTAGEN /note="F->L: No change of ligand-binding and IL6 signaling." DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" | |
154 | Q | S | e | 44.9 | 1n26_A | hetero IL6RB_HUMAN IL6_HUMAN | RVLTNMDKASQYEFGIP |
DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" | |
155 | N | S | e | 100.0 | 1n26_A | hetero IL6_HUMAN IL6RB_MOUSE IL6RB_HUMAN | NGRTVLDESAFIKPQY |
DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" | |
156 | S | S | e | 51.6 | 1n26_A | hetero IL6RB_HUMAN IL6RB_MOUSE | SLVWCPTGKMADEFINQRY |
DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" | |
157 | P | S | e | 90.7 | 1n26_A | hetero IL6RB_HUMAN IL6RB_MOUSE | EDAGKSTNYPVILQR |
DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" | |
158 | A | e | 43.8 | 1n26_A | hetero IL6RB_HUMAN IL6RB_MOUSE | AGSKNTCQRVEDILP |
DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" | ||
159 | E | E | e | 57.3 | 1n26_A | EDKRQTVGLSMAFINPY |
DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" | ||
160 | D | E | e | 32.7 | 1n26_A | DTESVKGILWAPR |
DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" | ||
161 | F | E | e | 27.3 | 1n26_A | FYHQLWASKNRVDITEGP |
DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" | ||
162 | Q | E | e | 59.7 | 1n26_A | QRIPTSAVEGKNMDFL |
DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" | ||
163 | E | E | e | 26.6 | 1n26_A | otherpoly | EKHSDNVYWRALFGIPQT |
DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" | |
164 | P | E | e | 64.3 | 1n26_A | otherpoly | PEQYSTKNRAGLVDFHIM |
DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" | |
165 | C | E | b | 11.3 | 1n26_A | CSKNRVFADEGILPQTWY |
MUTAGEN /note="C->L: Complete loss of ligand-binding." DISULFID ECO:0000269|PubMed:10066782" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" MUTAGEN /note="C->L: Complete loss of ligand-binding." DISULFID ECO:0000269|PubMed:10066782" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" | ||
166 | Q | E | e | 52.6 | 1n26_A | otherpoly | KEPQFRCDNAGILSTV |
DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" | |
167 | Y | E | e | 26.5 | 1n26_A | YDREHILSTAGKPV |
DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" | ||
168 | S | E | e | 28.9 | 1n26_A | YSTKPQDCEIRL |
DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" | ||
169 | Q | T | e | 78.1 | 1n26_A | VQKHLRCFDNI |
DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" | ||
170 | E | T | e | 98.0 | 1n26_A | ETPRDKAGQSY |
DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" | ||
171 | S | T | e | 46.1 | 1n26_A | CALSGQVYPTDKH |
DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" | ||
172 | Q | T | e | 32.1 | 1n26_A | QGLSTKDNEH |
DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" | ||
173 | K | E | e | 34.0 | 1n26_A | PESKRDCGL |
DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" | ||
174 | F | E | b | 1.9 | 1n26_A | NLFGTDHYAEIKPQRSV |
MUTAGEN /note="F->L: No change of ligand-binding and IL6 signaling." DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" MUTAGEN /note="F->L: No change of ligand-binding and IL6 signaling." DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" | ||
175 | S | E | e | 21.9 | 1n26_A | SGRKFTADEILPV |
DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" | ||
176 | C | E | b | 0.0 | 1n26_A | CILAVEGSTDFHKMNPQRY |
MUTAGEN /note="C->A: Complete loss of ligand-binding." DISULFID ECO:0000269|PubMed:10066782" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" MUTAGEN /note="C->A: Complete loss of ligand-binding." DISULFID ECO:0000269|PubMed:10066782" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" | ||
177 | Q | E | e | 44.9 | 1n26_A | otherpoly | HYDQTNMVAEFGKLSCIPR |
DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" | |
178 | L | E | b | 1.1 | 1n26_A | IVFLMRCAEGKSTDHNPQY |
DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" | ||
179 | A | e | 59.8 | 1n26_A | ATSPDGHENRCFIKLQV |
DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" | |||
180 | V | b | 4.7 | 1n26_A | CKVYIGRALSDEFHMNPQT |
DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" | |||
181 | P | e | 55.8 | 1n26_A | hetero IL6_HUMAN | PMQAKDLNVEFGIRSTY |
DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" | ||
182 | E | T | e | 31.7 | 1n26_A | hetero IL6_HUMAN | EAHLTYDKSNFGIPQRV |
DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" | |
183 | G | T | e | 63.1 | 1n26_A | hetero IL6_HUMAN compound CYS | AGTFLSKDEINPQRV |
DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" | |
184 | D | b | 5.6 | 1n26_A | compound CYS | ESDALWFPNYHGIKQRTV |
MUTAGEN /note="D->T: 30% decrease of ligand-binding and IL6 signaling." DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" MUTAGEN /note="D->T: 30% decrease of ligand-binding and IL6 signaling." DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" | ||
185 | S | e | 64.1 | 1n26_A | hetero IL6_HUMAN compound CYS | ESTIGMFKNP |
DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" | ||
186 | S | b | 2.3 | 1n26_A | TSVEKAPR |
DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" | |||
187 | F | E | e | 46.9 | 1n26_A | hetero IL6_HUMAN IL6RB_HUMAN IL6RB_MOUSE | LIYPWFTRSKQVMN |
DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" | |
188 | Y | E | b | 0.9 | 1n26_A | YPFHRL |
DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" | ||
189 | I | E | e | 23.4 | 1n26_A | hetero IL6RB_HUMAN IL6RB_MOUSE IL6_HUMAN | IKVFNTER |
DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" | |
190 | V | E | b | 0.0 | 1n26_A | VIENALTM |
MUTAGEN /note="V->G: 80% decrease of ligand-binding and no IL6 signaling." DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" MUTAGEN /note="V->G: 80% decrease of ligand-binding and no IL6 signaling." DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" | ||
191 | S | E | b | 0.0 | 1n26_A | VTNKSWREGMQIL |
DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" | ||
192 | M | E | b | 0.0 | 1n26_A | VLITM |
DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" | ||
193 | C | E | b | 6.0 | 1n26_A | TVECNASKLM |
MUTAGEN /note="C->D: Complete loss of ligand-binding." DOMAIN /note="Fibronectin type-III 1" DISULFID ECO:0000269|PubMed:10066782" TOPO_DOM /note="Extracellular" MUTAGEN /note="C->D: Complete loss of ligand-binding." DOMAIN /note="Fibronectin type-III 1" DISULFID ECO:0000269|PubMed:10066782" TOPO_DOM /note="Extracellular" | ||
194 | V | E | b | 0.0 | 1n26_A | AVDEM |
DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" | ||
195 | A | E | b | 3.6 | 1n26_A | ATEIVKNS |
DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" | ||
196 | S | E | b | 0.0 | 1n26_A | NVIPAHS |
DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" | ||
197 | S | T | b | 10.9 | 1n26_A | HSAQPLERD |
DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" | ||
198 | V | T | e | 24.0 | 1n26_A | LKVMGHIWA |
DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" | ||
199 | G | E | e | 22.6 | 1n26_A | GLAKF |
DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" | ||
200 | S | E | e | 28.1 | 1n26_A | SKNAYHITV |
DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" | ||
201 | K | E | e | 43.9 | 1n26_A | SYKNATVQR |
DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" | ||
202 | F | E | e | 40.7 | 1n26_A | SETYCRFVNAGL |
DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" | ||
203 | S | b | 0.0 | 1n26_A | SNTLE |
DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" | |||
204 | K | e | 78.8 | 1n26_A | DYLEAHNTSRFK |
DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" | |||
205 | T | e | 32.5 | 1n26_A | hetero IL6RB_MOUSE IL6RB_HUMAN | PTIDNVYFSHLE |
DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" | ||
206 | Q | E | e | 33.7 | 1n26_A | SLVQIHERF |
DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" | ||
207 | T | E | e | 55.2 | 1n26_A | hetero IL6RB_HUMAN IL6RB_MOUSE | TSYNRDPAGV |
DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" | |
208 | F | E | b | 9.6 | 1n26_A | FVLI |
DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" | ||
209 | Q | E | e | 34.2 | 1n26_A | hetero IL6_HUMAN compound CYS | DFTQHISEY |
DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" | |
210 | G | T | b | 1.2 | 1n26_A | IVPSFELGTR |
DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" | ||
211 | C | T | e | 22.7 | 1n26_A | compound CYS | RLTVFEQYC |
MUTAGEN /note="C->A: No change of ligand-binding and IL6 signaling." DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" MUTAGEN /note="C->A: No change of ligand-binding and IL6 signaling." DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" | |
212 | G | T | e | 34.5 | 1n26_A | hetero IL6_HUMAN | DYSGKTHAL |
DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" | |
213 | I | b | 15.2 | 1n26_A | homo | IKVM |
DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" | ||
214 | L | B | b | 0.6 | 1n26_A | homo | VIL |
DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" | |
215 | Q | e | 29.1 | 1n26_A | hetero IL6RA_HUMAN homo | KQRETI |
DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" | ||
216 | P | b | 1.6 | 1n26_A | PT |
DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" | |||
217 | D | e | 32.1 | 1n26_A | hetero IL6RA_HUMAN homo | DLEGHNST |
MUTAGEN /note="D->V: Complete loss of ligand-binding." DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" MUTAGEN /note="D->V: Complete loss of ligand-binding." DOMAIN /note="Fibronectin type-III 1" TOPO_DOM /note="Extracellular" | ||
218 | P | e | 31.8 | 1n26_A | PS |
DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" | |||
219 | P | b | 4.7 | 1n26_A | P |
DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" | |||
220 | A | E | e | 22.3 | 1n26_A | compound NAG | KEVWAQHPYLRT |
DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" | |
221 | N | E | e | 67.3 | 1n26_A | compound NAG | NDGKSE |
CARBOHYD /note="N-linked (GlcNAc...) asparagine" ECO:0000269|PubMed:28060820" MUTAGEN /note="N->A: No effect on cleavage or sIL6R levels. No effect on IL6R signaling; when associated with A-55, A-93, A-245 and A-350. Loss of cleavage by ADAM17; when associated with A-55, A-93, A-245 and A-350." DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" CARBOHYD /note="N-linked (GlcNAc...) asparagine" ECO:0000269|PubMed:28060820" MUTAGEN /note="N->A: No effect on cleavage or sIL6R levels. No effect on IL6R signaling; when associated with A-55, A-93, A-245 and A-350. Loss of cleavage by ADAM17; when associated with A-55, A-93, A-245 and A-350." DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" | |
222 | I | E | b | 17.5 | 1n26_A | LVI |
DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" | ||
223 | T | E | e | 42.2 | 1n26_A | compound NAG | QRTVSHEAK |
DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" | |
224 | V | E | b | 13.3 | 1n26_A | LVIAM |
DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" | ||
225 | T | E | e | 46.1 | 1n26_A | homo | KESTRNI |
DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" | |
226 | A | E | e | 40.2 | 1n26_A | homo | PANSFLRQVCKT |
DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" | |
227 | V | e | 26.7 | 1n26_A | homo | VLKSIRQ |
DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" | ||
228 | A | T | e | 58.9 | 1n26_A | homo | PNEKASGHRDMQYFILTV |
DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" | |
229 | R | T | e | 82.6 | 1n26_A | homo | GKAEPSRNDV |
DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" | |
230 | N | e | 31.5 | 1n26_A | homo | NSLEYKDRT |
DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" | ||
231 | P | T | e | 39.5 | 1n26_A | PSDQVEGIK |
DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" | ||
232 | R | T | e | 45.8 | 1n26_A | hetero IL6RB_HUMAN IL6RB_MOUSE | RSDQMGTAL |
MUTAGEN /note="R->S: 30% decrease of ligand-binding and IL6 signaling." DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" MUTAGEN /note="R->S: 30% decrease of ligand-binding and IL6 signaling." DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" | |
233 | W | e | 31.9 | 1n26_A | hetero IL6RB_HUMAN IL6RB_MOUSE homo | QRYWIHT |
MUTAGEN /note="W->Q: 30% decrease of ligand-binding and increase of IL6 signaling." DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" MUTAGEN /note="W->Q: 30% decrease of ligand-binding and increase of IL6 signaling." DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" | ||
234 | L | E | b | 0.0 | 1n26_A | LVCGM |
DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" | ||
235 | S | E | e | 25.8 | 1n26_A | hetero | EWKTSHRQV |
DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" | |
236 | V | E | b | 0.0 | 1n26_A | VLAI |
DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" | ||
237 | T | E | e | 35.7 | 1n26_A | hetero compound NAG | STKQRALY |
DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" | |
238 | W | E | b | 3.6 | 1n26_A | hetero | W |
DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" | |
239 | Q | E | e | 46.4 | 1n26_A | hetero compound NAG | EQSTVRLF |
DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" | |
240 | D | e | 30.9 | 1n26_A | hetero compound NAG | YPDNSTH |
DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" | ||
241 | P | b | 4.7 | 1n26_A | compound NAG | PEADGIKLNQRSTV |
DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" | ||
242 | H | T | e | 99.0 | 1n26_A | compound NAG | DATSGPELRHIKNQV |
DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" | |
243 | S | T | e | 25.8 | 1n26_A | hetero IL6RA_HUMAN homo | STDALQIKMG |
DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" | |
244 | W | b | 4.0 | 1n26_A | hetero IL6RA_HUMAN homo | WVALGTDEFIKNPQRS |
DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" | ||
245 | N | e | 61.8 | 1n26_A | hetero IL6RA_HUMAN compound NAG otherpoly homo | SDRKLFNAEGIPQTV |
SITE /note="Not glycosylated" CARBOHYD /note="N-linked (GlcNAc...) asparagine" MUTAGEN /note="N->A: Slightly induces cleavage and sIL6R levels.No effect on IL6R signaling; when associated with A-55, A-93, A-221 and A-350. Loss of cleavage by ADAM17; when associated with A-55, A-93, A-221 and A-350." DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" SITE /note="Not glycosylated" CARBOHYD /note="N-linked (GlcNAc...) asparagine" MUTAGEN /note="N->A: Slightly induces cleavage and sIL6R levels.No effect on IL6R signaling; when associated with A-55, A-93, A-221 and A-350. Loss of cleavage by ADAM17; when associated with A-55, A-93, A-221 and A-350." DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" | ||
246 | S | e | 33.6 | 1n26_A | hetero IL6_HUMAN otherpoly | TPSDRAGKQEILV |
DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" | ||
247 | S | S | e | 71.9 | 1n26_A | hetero IL6_HUMAN | SEGQFPY |
DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" | |
248 | F | S | e | 78.5 | 1n26_A | hetero IL6_HUMAN compound NAG | YWSHILGFV |
DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" | |
249 | Y | S | e | 20.4 | 1n26_A | hetero IL6_HUMAN IL6RA_HUMAN compound NAG homo | FLYIN |
DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" | |
250 | R | e | 43.9 | 1n26_A | hetero IL6_HUMAN | SLTVRPIQHDM |
DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" | ||
251 | L | E | b | 1.1 | 1n26_A | hetero | LAIVM |
DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" | |
252 | R | E | e | 33.2 | 1n26_A | hetero | KTQLHIDEMR |
DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" | |
253 | F | E | b | 0.0 | 1n26_A | hetero | FYNS |
DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" | |
254 | E | E | b | 15.6 | 1n26_A | hetero | ERCQFDSWGHNL |
MUTAGEN /note="E->A: 50% decrease of ligand-binding and IL6 signaling." DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" MUTAGEN /note="E->A: 50% decrease of ligand-binding and IL6 signaling." DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" | |
255 | L | E | b | 0.0 | 1n26_A | LIV |
DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" | ||
256 | R | E | e | 22.9 | 1n26_A | RQ |
DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" | ||
257 | Y | E | b | 3.5 | 1n26_A | hetero IL6RB_HUMAN IL6RB_MOUSE | YVLAIT |
DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" | |
258 | R | E | b | 18.6 | 1n26_A | RKQHY |
DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" | ||
259 | A | E | b | 3.6 | 1n26_A | PGRTVAEL |
DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" | ||
260 | E | T | e | 43.2 | 1n26_A | KEALVQIS |
DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" | ||
261 | R | T | e | 66.0 | 1n26_A | hetero IL6RB_HUMAN IL6RB_MOUSE | DNKEQRIWGSYTH |
DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" | |
262 | S | e | 45.3 | 1n26_A | hetero IL6RB_HUMAN IL6RB_MOUSE | ASKHELNDYT |
DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" | ||
263 | K | S | e | 91.0 | 1n26_A | hetero IL6RB_HUMAN IL6RB_MOUSE | RKEAPSTDL |
DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" | |
264 | T | e | 68.8 | 1n26_A | hetero IL6RB_HUMAN | ETSALRKDQIG |
DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" | ||
265 | F | e | 26.8 | 1n26_A | hetero IL6RB_MOUSE | WFKDEGLSRA |
DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" | ||
266 | T | E | e | 39.6 | 1n26_A | hetero IL6RB_HUMAN IL6RB_MOUSE | ETKNSIQVHDW |
DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" | |
267 | T | E | e | 43.5 | 1n26_A | TDMQEHSVLRI |
DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" | ||
268 | W | E | e | 33.9 | 1n26_A | hetero IL6RB_MOUSE IL6RB_HUMAN | VWHILRQFKNADEGPST |
DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" | |
269 | M | E | e | 42.0 | 1n26_A | hetero IL6RB_MOUSE | FPLNEMKHITQSVADGR |
DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" | |
270 | V | b | 3.3 | 1n26_A | hetero | VALFPSDHCIT |
DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" | ||
271 | K | G | e | 63.2 | 1n26_A | hetero IL6RB_HUMAN IL6RB_MOUSE | ETAVGDQKSPHLM |
DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" | |
272 | D | G | e | 80.2 | 1n26_A | hetero | DKGPNQTEVF |
DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" | |
273 | L | G | b | 16.9 | 1n26_A | hetero IL6_HUMAN precipitant | TALIVKGNQSEDPR |
DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" | |
274 | Q | e | 36.2 | 1n26_A | hetero precipitant | QTKSRGEA |
DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" | ||
275 | H | S | e | 27.2 | 1n26_A | hetero precipitant | TSGAHKLCENPY |
DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" | |
276 | H | E | e | 42.4 | 1n26_A | hetero precipitant | QSHAERTKVGM |
DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" | |
277 | C | E | b | 11.3 | 1n26_A | CFTEHKLYSAIDGNPQRV |
MUTAGEN /note="C->D: 30% increase of ligand-binding and 100% increase in IL6 signaling." DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" MUTAGEN /note="C->D: 30% increase of ligand-binding and 100% increase in IL6 signaling." DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" | ||
278 | V | E | e | 27.3 | 1n26_A | VKTDRICFNL |
MUTAGEN /note="V->N: 50% Decrease of ligand-binding and 50% increase in IL6 signaling." DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" MUTAGEN /note="V->N: 50% Decrease of ligand-binding and 50% increase in IL6 signaling." DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" | ||
279 | I | E | b | 0.0 | 1n26_A | ILVTHCMS |
MUTAGEN /note="I->D: Complete loss of ligand-binding." DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" MUTAGEN /note="I->D: Complete loss of ligand-binding." DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" | I->N:(0.0 %):LP/P Hyper-IgE syndrome 5, autosomal recessive, with recurrent infections (HIES5) dbSNP:rs1689606 [MIM:618944] | |
280 | H | S | e | 51.3 | 1n26_A | hetero IL6RB_HUMAN IL6RB_MOUSE | TLFKHQCRAVNS |
MUTAGEN /note="H->I: No change of ligand-binding and no IL6 signaling." DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" MUTAGEN /note="H->I: No change of ligand-binding and no IL6 signaling." DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" | H->P:(0.0 %):US Hyper-IgE syndrome 5, autosomal recessive, with recurrent infections (HIES5) [MIM:618944] |
281 | D | S | e | 39.5 | 1n26_A | hetero IL6RB_HUMAN IL6RB_MOUSE | DRSGHCKNT |
MUTAGEN /note="D->G: 70% decrease of ligand-binding and no IL6 signaling." DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" MUTAGEN /note="D->G: 70% decrease of ligand-binding and no IL6 signaling." DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" | |
282 | A | b | 0.0 | 1n26_A | hetero IL6RB_MOUSE | LAKCGST |
DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" | ||
283 | W | e | 57.8 | 1n26_A | hetero IL6RB_HUMAN IL6RB_MOUSE | KYVNRLDWQHAEFGIPST |
DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" | ||
284 | S | T | e | 53.9 | 1n26_A | hetero IL6RB_MOUSE | PARSGKCDEFILNQTV |
DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" | |
285 | G | T | e | 45.2 | 1n26_A | GFRKSQADEILNPTV |
MUTAGEN /note="G->D: 80% decrease of ligand-binding and no IL6 signaling." DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" MUTAGEN /note="G->D: 80% decrease of ligand-binding and no IL6 signaling." DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" | ||
286 | L | e | 25.3 | 1n26_A | TKLQAMVIGFDENPRSY |
DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" | |||
287 | R | e | 54.2 | 1n26_A | homo | EKRPVTLNADFGIQSY |
DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" | ||
288 | H | E | b | 1.0 | 1n26_A | YHAGLSDEFIKNPQRTV |
DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" | ||
289 | V | E | b | 4.0 | 1n26_A | VELIAFNSYDGKPRT |
DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" | ||
290 | V | E | b | 0.0 | 1n26_A | VFIL |
DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" | ||
291 | Q | E | b | 11.2 | 1n26_A | QRSE |
MUTAGEN /note="Q->K: Complete loss of ligand-binding." DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" MUTAGEN /note="Q->K: Complete loss of ligand-binding." DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" | ||
292 | L | E | b | 0.0 | 1n26_A | VILT |
DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" | ||
293 | R | E | e | 26.1 | 1n26_A | hetero precipitant | RSQAH |
MUTAGEN /note="R->G: Complete loss of ligand-binding." DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" MUTAGEN /note="R->G: Complete loss of ligand-binding." DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" | |
294 | A | E | b | 0.0 | 1n26_A | ACSG |
DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" | ||
295 | Q | E | b | 15.8 | 1n26_A | hetero | KRQIMNT |
DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" | |
296 | E | E | b | 0.5 | 1n26_A | hetero IL6_HUMAN | DPEKLAGSTV |
DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" | |
297 | E | T | b | 15.1 | 1n26_A | hetero IL6_HUMAN | RDEHFNPL |
DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" | |
298 | F | T | e | 75.1 | 1n26_A | hetero IL6_HUMAN compound ATP | LYFTDNSHAGEIKPQRV |
DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" | |
299 | G | T | e | 58.3 | 1n26_A | hetero | YDGESQAFIKLNPRTV |
DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" | |
300 | Q | B | b | 19.4 | 1n26_A | hetero IL6_HUMAN | HSKAINGPYLQ |
DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" | |
301 | G | S | b | 16.7 | 1n26_A | GS |
DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" | ||
302 | E | e | 60.3 | 1n26_A | precipitant | SYTEFIQLR |
DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" | ||
303 | W | b | 19.1 | 1n26_A | hetero precipitant | WL |
MOTIF /note="WSXWS motif" REGION /note="Disordered" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" MOTIF /note="WSXWS motif" REGION /note="Disordered" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" | ||
304 | S | b | 2.3 | 1n26_A | SN |
MOTIF /note="WSXWS motif" REGION /note="Disordered" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" MOTIF /note="WSXWS motif" REGION /note="Disordered" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" | |||
305 | E | e | 62.8 | 1n26_A | EDANRTKV |
MOTIF /note="WSXWS motif" REGION /note="Disordered" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" MOTIF /note="WSXWS motif" REGION /note="Disordered" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" | |||
306 | W | e | 20.3 | 1n26_A | W |
MOTIF /note="WSXWS motif" REGION /note="Disordered" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" MOTIF /note="WSXWS motif" REGION /note="Disordered" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" | |||
307 | S | b | 0.0 | 1n26_A | SAT |
MOTIF /note="WSXWS motif" REGION /note="Disordered" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" MOTIF /note="WSXWS motif" REGION /note="Disordered" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" | |||
308 | P | e | 82.9 | 1n26_A | PEVLQSA |
REGION /note="Disordered" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" REGION /note="Disordered" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" | |||
309 | E | e | 58.3 | 1n26_A | compound NAG | EATP |
REGION /note="Disordered" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" REGION /note="Disordered" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" | ||
310 | A | E | b | 13.4 | 1n26_A | compound NAG | ASV |
REGION /note="Disordered" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" REGION /note="Disordered" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" | |
311 | M | E | e | 36.7 | 1n26_A | compound NAG homo | TSWHAFLM |
COMPBIAS /note="Polar residues" REGION /note="Disordered" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" COMPBIAS /note="Polar residues" REGION /note="Disordered" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" | |
312 | G | E | b | 16.7 | 1n26_A | homo | GASR |
COMPBIAS /note="Polar residues" REGION /note="Disordered" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" COMPBIAS /note="Polar residues" REGION /note="Disordered" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" | |
313 | T | e | 37.7 | 1n26_A | homo | TI |
COMPBIAS /note="Polar residues" REGION /note="Disordered" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" COMPBIAS /note="Polar residues" DISORDER predicted by DISOPRED REGION /note="Disordered" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" | ||
314 | P | b | 2.3 | 1n26_A | PTQ |
COMPBIAS /note="Polar residues" REGION /note="Disordered" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" COMPBIAS /note="Polar residues" DISORDER predicted by DISOPRED REGION /note="Disordered" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" | |||
315 | W | e | 30.3 | 1n26_A | homo | WSYRADEGIKLPTV |
COMPBIAS /note="Polar residues" REGION /note="Disordered" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" COMPBIAS /note="Polar residues" DISORDER predicted by DISOPRED REGION /note="Disordered" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" | ||
316 | T | e | 49.4 | 1n26_A | homo | TESAI |
COMPBIAS /note="Polar residues" REGION /note="Disordered" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" COMPBIAS /note="Polar residues" DISORDER predicted by DISOPRED REGION /note="Disordered" DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" | ||
317 | E | e | 81.9 | 1n26_A | homo | EDGP |
COMPBIAS /note="Polar residues" REGION /note="Disordered" TOPO_DOM /note="Extracellular" COMPBIAS /note="Polar residues" DISORDER predicted by DISOPRED REGION /note="Disordered" TOPO_DOM /note="Extracellular" | ||
318 | S | e | 137.5 | 1n26_A | homo | SRPETADGIKLV |
COMPBIAS /note="Polar residues" REGION /note="Disordered" TOPO_DOM /note="Extracellular" COMPBIAS /note="Polar residues" DISORDER predicted by DISOPRED REGION /note="Disordered" TOPO_DOM /note="Extracellular" | ||
319 | R | - | - | - | - | RKPEADGILSTV |
COMPBIAS /note="Polar residues" REGION /note="Disordered" TOPO_DOM /note="Extracellular" COMPBIAS /note="Polar residues" DISORDER predicted by DISOPRED REGION /note="Disordered" TOPO_DOM /note="Extracellular" | ||
320 | S | - | - | - | - | ESAGTDIKLPRV |
COMPBIAS /note="Polar residues" REGION /note="Disordered" TOPO_DOM /note="Extracellular" COMPBIAS /note="Polar residues" DISORDER predicted by DISOPRED REGION /note="Disordered" TOPO_DOM /note="Extracellular" | ||
321 | P | - | - | - | - | PTIRSADEGKLV |
COMPBIAS /note="Polar residues" REGION /note="Disordered" TOPO_DOM /note="Extracellular" COMPBIAS /note="Polar residues" DISORDER predicted by DISOPRED REGION /note="Disordered" TOPO_DOM /note="Extracellular" | ||
322 | P | - | - | - | - | PI |
COMPBIAS /note="Polar residues" REGION /note="Disordered" TOPO_DOM /note="Extracellular" COMPBIAS /note="Polar residues" DISORDER predicted by DISOPRED REGION /note="Disordered" TOPO_DOM /note="Extracellular" | ||
323 | A | - | - | - | - | AGL |
COMPBIAS /note="Polar residues" REGION /note="Disordered" TOPO_DOM /note="Extracellular" COMPBIAS /note="Polar residues" DISORDER predicted by DISOPRED REGION /note="Disordered" TOPO_DOM /note="Extracellular" | ||
324 | E | - | - | - | - | EMQWAGLSDFIKNPRTVY |
COMPBIAS /note="Polar residues" REGION /note="Disordered" TOPO_DOM /note="Extracellular" COMPBIAS /note="Polar residues" DISORDER predicted by DISOPRED REGION /note="Disordered" TOPO_DOM /note="Extracellular" | ||
325 | N | - | - | - | - | GLDTN |
COMPBIAS /note="Polar residues" REGION /note="Disordered" TOPO_DOM /note="Extracellular" COMPBIAS /note="Polar residues" DISORDER predicted by DISOPRED REGION /note="Disordered" TOPO_DOM /note="Extracellular" | ||
326 | E | - | - | - | - | ENIQ |
COMPBIAS /note="Polar residues" REGION /note="Disordered" TOPO_DOM /note="Extracellular" COMPBIAS /note="Polar residues" DISORDER predicted by DISOPRED REGION /note="Disordered" TOPO_DOM /note="Extracellular" | ||
327 | V | - | - | - | - | LVIP |
COMPBIAS /note="Polar residues" REGION /note="Disordered" TOPO_DOM /note="Extracellular" COMPBIAS /note="Polar residues" DISORDER predicted by DISOPRED REGION /note="Disordered" TOPO_DOM /note="Extracellular" | ||
328 | S | - | - | - | - | WHPSGADEFIKLNQRTVY |
COMPBIAS /note="Polar residues" REGION /note="Disordered" TOPO_DOM /note="Extracellular" COMPBIAS /note="Polar residues" DISORDER predicted by DISOPRED REGION /note="Disordered" TOPO_DOM /note="Extracellular" | ||
329 | T | - | - | - | - | TNYLADEFGIKPQRSV |
TOPO_DOM /note="Extracellular" DISORDER predicted by DISOPRED TOPO_DOM /note="Extracellular" | ||
330 | P | - | - | - | - | PMSADEFGIKLNQRTVY |
TOPO_DOM /note="Extracellular" DISORDER predicted by DISOPRED TOPO_DOM /note="Extracellular" | ||
331 | M | - | - | - | - | TRDMAEFGIKLNPQSVY |
TOPO_DOM /note="Extracellular" DISORDER predicted by DISOPRED TOPO_DOM /note="Extracellular" | ||
332 | Q | - | - | - | - | QW |
TOPO_DOM /note="Extracellular" TOPO_DOM /note="Extracellular" | ||
333 | A | - | - | - | - | AHVPS |
TOPO_DOM /note="Extracellular" DISORDER predicted by DISOPRED TOPO_DOM /note="Extracellular" | ||
334 | L | - | - | - | - | ISEQPL |
TOPO_DOM /note="Extracellular" DISORDER predicted by DISOPRED TOPO_DOM /note="Extracellular" | ||
335 | T | - | - | - | - | VDTG |
TOPO_DOM /note="Extracellular" TOPO_DOM /note="Extracellular" | ||
336 | T | - | - | - | - | ETYH |
TOPO_DOM /note="Extracellular" TOPO_DOM /note="Extracellular" | ||
337 | N | - | - | - | - | NDGP |
TOPO_DOM /note="Extracellular" TOPO_DOM /note="Extracellular" | ||
338 | K | - | - | - | - | QREKSY |
TOPO_DOM /note="Extracellular" TOPO_DOM /note="Extracellular" | ||
339 | D | - | - | - | - | QDVA |
TOPO_DOM /note="Extracellular" TOPO_DOM /note="Extracellular" | ||
340 | D | - | - | - | - | DQNL |
TOPO_DOM /note="Extracellular" TOPO_DOM /note="Extracellular" | ||
341 | D | - | - | - | - | EIHSD |
TOPO_DOM /note="Extracellular" DISORDER predicted by DISOPRED TOPO_DOM /note="Extracellular" | ||
342 | N | - | - | - | - | SEAPDN |
TOPO_DOM /note="Extracellular" DISORDER predicted by DISOPRED TOPO_DOM /note="Extracellular" | ||
343 | I | - | - | - | - | ILDAV |
TOPO_DOM /note="Extracellular" DISORDER predicted by DISOPRED TOPO_DOM /note="Extracellular" | ||
344 | L | - | - | - | - | FQPVSL |
TOPO_DOM /note="Extracellular" DISORDER predicted by DISOPRED TOPO_DOM /note="Extracellular" | ||
345 | F | - | - | - | - | WYAPSF |
TOPO_DOM /note="Extracellular" DISORDER predicted by DISOPRED TOPO_DOM /note="Extracellular" | ||
346 | R | - | - | - | - | KRQEG |
TOPO_DOM /note="Extracellular" DISORDER predicted by DISOPRED TOPO_DOM /note="Extracellular" | ||
347 | D | - | - | - | - | ENSPD |
TOPO_DOM /note="Extracellular" DISORDER predicted by DISOPRED TOPO_DOM /note="Extracellular" | ||
348 | S | - | - | - | - | SD |
TOPO_DOM /note="Extracellular" DISORDER predicted by DISOPRED TOPO_DOM /note="Extracellular" | ||
349 | A | - | - | - | - | ATLS |
TOPO_DOM /note="Extracellular" DISORDER predicted by DISOPRED TOPO_DOM /note="Extracellular" | ||
350 | N | - | - | - | - | NEPQ |
CARBOHYD /note="N-linked (GlcNAc...) asparagine" MUTAGEN /note="N->A: No effect on IL6R signaling; when associated with A-55, A-93, A-221 and A-245. Loss of cleavage by ADAM17; when associated with A-55, A-93, A-221 and A-245." TOPO_DOM /note="Extracellular" CARBOHYD /note="N-linked (GlcNAc...) asparagine" MUTAGEN /note="N->A: No effect on IL6R signaling; when associated with A-55, A-93, A-221 and A-245. Loss of cleavage by ADAM17; when associated with A-55, A-93, A-221 and A-245." DISORDER predicted by DISOPRED TOPO_DOM /note="Extracellular" | ||
351 | A | - | - | - | - | AP |
TOPO_DOM /note="Extracellular" DISORDER predicted by DISOPRED TOPO_DOM /note="Extracellular" | ||
352 | T | - | - | - | - | THP |
CARBOHYD /note="O-linked (GlcNAc) threonine" MUTAGEN /note="T->A: No effect on IL6R signaling." TOPO_DOM /note="Extracellular" CARBOHYD /note="O-linked (GlcNAc) threonine" MUTAGEN /note="T->A: No effect on IL6R signaling." DISORDER predicted by DISOPRED TOPO_DOM /note="Extracellular" | ||
353 | S | - | - | - | - | SAP |
TOPO_DOM /note="Extracellular" DISORDER predicted by DISOPRED TOPO_DOM /note="Extracellular" | ||
354 | L | - | - | - | - | RLV |
TOPO_DOM /note="Extracellular" DISORDER predicted by DISOPRED TOPO_DOM /note="Extracellular" | ||
355 | P | - | - | - | - | PL |
MUTAGEN /note="P->I,D: Reduces cleavage by ADAM17." SITE /note="Cleavage; by ADAM10 and ADAM17" MUTAGEN /note="PV->IE: Abolishes cleavage by ADAM17." TOPO_DOM /note="Extracellular" MUTAGEN /note="P->I,D: Reduces cleavage by ADAM17." SITE /note="Cleavage; by ADAM10 and ADAM17" MUTAGEN /note="PV->IE: Abolishes cleavage by ADAM17." TOPO_DOM /note="Extracellular" | ||
356 | V | - | - | - | - | VLS |
MUTAGEN /note="V->E,G: Abolishes cleavage by ADAM17." SITE /note="Cleavage; by ADAM10 and ADAM17" MUTAGEN /note="PV->IE: Abolishes cleavage by ADAM17." TOPO_DOM /note="Extracellular" MUTAGEN /note="V->E,G: Abolishes cleavage by ADAM17." DISORDER predicted by DISOPRED SITE /note="Cleavage; by ADAM10 and ADAM17" MUTAGEN /note="PV->IE: Abolishes cleavage by ADAM17." TOPO_DOM /note="Extracellular" | ||
357 | Q | - | - | - | - | QDL |
TOPO_DOM /note="Extracellular" TOPO_DOM /note="Extracellular" | ||
358 | D | - | - | - | - | DHQEG |
TOPO_DOM /note="Extracellular" DISORDER predicted by DISOPRED TOPO_DOM /note="Extracellular" | D->A:(0.0 %):LB/B - dbSNP:rs2228145 | |
359 | S | - | - | - | - | SPR |
TOPO_DOM /note="Extracellular" TOPO_DOM /note="Extracellular" | ||
360 | S | - | - | - | - | SDA |
TOPO_DOM /note="Extracellular" TOPO_DOM /note="Extracellular" | ||
361 | S | - | - | - | - | SP |
TOPO_DOM /note="Extracellular" TOPO_DOM /note="Extracellular" | ||
362 | V | - | - | - | - | VRIM |
TOPO_DOM /note="Extracellular" TOPO_DOM /note="Extracellular" | ||
363 | P | - | - | - | - | PES |
TOPO_DOM /note="Extracellular" TOPO_DOM /note="Extracellular" | ||
364 | L | - | - | - | - | LQ |
TOPO_DOM /note="Extracellular" TOPO_DOM /note="Extracellular" | ||
365 | P | - | - | - | - | PV |
TOPO_DOM /note="Extracellular" TOPO_DOM /note="Extracellular" | ||
366 | T | - | - | - | - | TAL |
TRANSMEM /note="Helical" TRANSMEM /note="Helical" | ||
367 | F | - | - | - | - | FEV |
TRANSMEM /note="Helical" TRANSMEM /note="Helical" | ||
368 | L | - | - | - | - | LQ |
TRANSMEM /note="Helical" TRANSMEM /note="Helical" | ||
369 | V | - | - | - | - | V |
TRANSMEM /note="Helical" TRANSMEM /note="Helical" | ||
370 | A | - | - | - | - | AS |
TRANSMEM /note="Helical" TRANSMEM /note="Helical" | ||
371 | G | - | - | - | - | GLV |
TRANSMEM /note="Helical" TRANSMEM /note="Helical" | ||
372 | G | - | - | - | - | GA |
TRANSMEM /note="Helical" TRANSMEM /note="Helical" | ||
373 | S | - | - | - | - | SI |
TRANSMEM /note="Helical" TRANSMEM /note="Helical" | ||
374 | L | - | - | - | - | L |
TRANSMEM /note="Helical" TRANSMEM /note="Helical" | ||
375 | A | - | - | - | - | AGS |
TRANSMEM /note="Helical" TRANSMEM /note="Helical" | ||
376 | F | - | - | - | - | FI |
TRANSMEM /note="Helical" TRANSMEM /note="Helical" | ||
377 | G | - | - | - | - | GFL |
TRANSMEM /note="Helical" TRANSMEM /note="Helical" | ||
378 | T | - | - | - | - | TLGS |
TRANSMEM /note="Helical" TRANSMEM /note="Helical" | ||
379 | L | - | - | - | - | LC |
TRANSMEM /note="Helical" TRANSMEM /note="Helical" | ||
380 | L | - | - | - | - | LV |
TRANSMEM /note="Helical" TRANSMEM /note="Helical" | ||
381 | C | - | - | - | - | CAG |
TRANSMEM /note="Helical" TRANSMEM /note="Helical" | ||
382 | I | - | - | - | - | IVGL |
TRANSMEM /note="Helical" TRANSMEM /note="Helical" | ||
383 | A | - | - | - | - | AFG |
TRANSMEM /note="Helical" TRANSMEM /note="Helical" | ||
384 | I | - | - | - | - | ILV |
TRANSMEM /note="Helical" TRANSMEM /note="Helical" | ||
385 | V | - | - | - | - | IAGV |
TRANSMEM /note="Helical" TRANSMEM /note="Helical" | V->I:(43.0 %):LB/B - dbSNP:rs2228146 | |
386 | L | - | - | - | - | LA |
TRANSMEM /note="Helical" TRANSMEM /note="Helical" | ||
387 | R | - | - | - | - | RGL |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
388 | F | - | - | - | - | LFA |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
389 | K | - | - | - | - | KLAGSDEFINPQRTVY |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
390 | K | - | - | - | - | KGQALSDEFINPRTVY |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
391 | T | - | - | - | - | TKLAGSDEFINPQRVY |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
392 | W | - | - | - | - | WG |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
393 | K | - | - | - | - | KQLAEGSVDFINPRTCHMWY |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
394 | L | - | - | - | - | LS |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
395 | R | - | - | - | - | RQE |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
396 | A | - | - | - | - | AL |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
397 | L | - | - | - | - | RLE |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
398 | K | - | - | - | - | KR |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
399 | E | - | - | - | - | EGS |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
400 | G | - | - | - | - | GS |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
401 | K | - | - | - | - | K |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
402 | T | - | - | - | - | TD |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
403 | S | - | - | - | - | GTNS |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
404 | M | - | - | - | - | PSM |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
405 | H | - | - | - | - | PHQ |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
406 | P | - | - | - | - | PK |
TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
407 | P | - | - | - | - | P |
TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
408 | Y | - | - | - | - | YG |
TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
409 | S | - | - | - | - | SFLP |
TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
410 | L | - | - | - | - | L |
TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
411 | G | - | - | - | - | GA |
TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
412 | Q | - | - | - | - | PQS |
TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
413 | L | - | - | - | - | LMV |
TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
414 | V | - | - | - | - | IVLADEGKSTCFHMNPQRY |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
415 | P | - | - | - | - | PLADEGKSTVCFHIMNQRY |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
416 | E | - | - | - | - | EAGLDKPSTVFINQRYCHMW |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
417 | R | - | - | - | - | RAGLDEKPSTVFINQYCHMW |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
418 | P | - | - | - | - | PAGLDEKSTVFINQRYCHMW |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
419 | R | - | - | - | - | KR |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
420 | P | - | - | - | - | PS |
TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
421 | T | - | - | - | - | T |
REGION /note="Disordered" TOPO_DOM /note="Cytoplasmic" REGION /note="Disordered" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
422 | P | - | - | - | - | PF |
REGION /note="Disordered" TOPO_DOM /note="Cytoplasmic" REGION /note="Disordered" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
423 | V | - | - | - | - | VL |
REGION /note="Disordered" TOPO_DOM /note="Cytoplasmic" REGION /note="Disordered" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
424 | L | - | - | - | - | L |
REGION /note="Disordered" TOPO_DOM /note="Cytoplasmic" REGION /note="Disordered" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
425 | V | - | - | - | - | V |
REGION /note="Disordered" TOPO_DOM /note="Cytoplasmic" REGION /note="Disordered" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
426 | P | - | - | - | - | P |
REGION /note="Disordered" TOPO_DOM /note="Cytoplasmic" REGION /note="Disordered" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
427 | L | - | - | - | - | L |
REGION /note="Disordered" TOPO_DOM /note="Cytoplasmic" REGION /note="Disordered" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
428 | I | - | - | - | - | IL |
REGION /note="Disordered" TOPO_DOM /note="Cytoplasmic" REGION /note="Disordered" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
429 | S | - | - | - | - | STAEGLVDFHIKMNPQRY |
REGION /note="Disordered" TOPO_DOM /note="Cytoplasmic" REGION /note="Disordered" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
430 | P | - | - | - | - | PAEGLSVDFHIKMNQRTY |
REGION /note="Disordered" TOPO_DOM /note="Cytoplasmic" REGION /note="Disordered" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
431 | P | - | - | - | - | PSAEGLVDFHIKMNQRTY |
REGION /note="Disordered" TOPO_DOM /note="Cytoplasmic" REGION /note="Disordered" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
432 | V | - | - | - | - | VGAELSDFHIKMNPQRTY |
REGION /note="Disordered" TOPO_DOM /note="Cytoplasmic" REGION /note="Disordered" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
433 | S | - | - | - | - | ST |
REGION /note="Disordered" TOPO_DOM /note="Cytoplasmic" REGION /note="Disordered" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
434 | P | - | - | - | - | PH |
REGION /note="Disordered" TOPO_DOM /note="Cytoplasmic" REGION /note="Disordered" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
435 | S | - | - | - | - | NSH |
REGION /note="Disordered" TOPO_DOM /note="Cytoplasmic" REGION /note="Disordered" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
436 | S | - | - | - | - | S |
REGION /note="Disordered" TOPO_DOM /note="Cytoplasmic" REGION /note="Disordered" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
437 | L | - | - | - | - | LS |
REGION /note="Disordered" TOPO_DOM /note="Cytoplasmic" REGION /note="Disordered" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
438 | G | - | - | - | - | G |
REGION /note="Disordered" TOPO_DOM /note="Cytoplasmic" REGION /note="Disordered" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
439 | S | - | - | - | - | STAEGLVDFHIKMNPQRY |
REGION /note="Disordered" TOPO_DOM /note="Cytoplasmic" REGION /note="Disordered" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
440 | D | - | - | - | - | D |
REGION /note="Disordered" TOPO_DOM /note="Cytoplasmic" REGION /note="Disordered" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
441 | N | - | - | - | - | N |
REGION /note="Disordered" TOPO_DOM /note="Cytoplasmic" REGION /note="Disordered" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
442 | T | - | - | - | - | T |
REGION /note="Disordered" TOPO_DOM /note="Cytoplasmic" REGION /note="Disordered" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
443 | S | - | - | - | - | SGV |
REGION /note="Disordered" TOPO_DOM /note="Cytoplasmic" REGION /note="Disordered" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
444 | S | - | - | - | - | SRN |
REGION /note="Disordered" TOPO_DOM /note="Cytoplasmic" REGION /note="Disordered" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
445 | H | - | - | - | - | HN |
REGION /note="Disordered" TOPO_DOM /note="Cytoplasmic" REGION /note="Disordered" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
446 | N | - | - | - | - | SN |
REGION /note="Disordered" TOPO_DOM /note="Cytoplasmic" REGION /note="Disordered" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
447 | R | - | - | - | - | RC |
REGION /note="Disordered" TOPO_DOM /note="Cytoplasmic" REGION /note="Disordered" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
448 | P | - | - | - | - | PL |
REGION /note="Disordered" TOPO_DOM /note="Cytoplasmic" REGION /note="Disordered" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
449 | D | - | - | - | - | GDE |
REGION /note="Disordered" TOPO_DOM /note="Cytoplasmic" REGION /note="Disordered" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
450 | A | - | - | - | - | AV |
REGION /note="Disordered" TOPO_DOM /note="Cytoplasmic" REGION /note="Disordered" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
451 | R | - | - | - | - | R |
REGION /note="Disordered" TOPO_DOM /note="Cytoplasmic" REGION /note="Disordered" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
452 | D | - | - | - | - | DG |
REGION /note="Disordered" TOPO_DOM /note="Cytoplasmic" REGION /note="Disordered" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
453 | P | - | - | - | - | PA |
REGION /note="Disordered" TOPO_DOM /note="Cytoplasmic" REGION /note="Disordered" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
454 | R | - | - | - | - | QR |
REGION /note="Disordered" TOPO_DOM /note="Cytoplasmic" REGION /note="Disordered" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
455 | S | - | - | - | - | SC |
REGION /note="Disordered" TOPO_DOM /note="Cytoplasmic" REGION /note="Disordered" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
456 | P | - | - | - | - | P |
REGION /note="Disordered" TOPO_DOM /note="Cytoplasmic" REGION /note="Disordered" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
457 | Y | - | - | - | - | YN |
REGION /note="Disordered" TOPO_DOM /note="Cytoplasmic" REGION /note="Disordered" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
458 | D | - | - | - | - | D |
REGION /note="Disordered" TOPO_DOM /note="Cytoplasmic" REGION /note="Disordered" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
459 | I | - | - | - | - | NIV |
REGION /note="Disordered" TOPO_DOM /note="Cytoplasmic" REGION /note="Disordered" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
460 | S | - | - | - | - | S |
REGION /note="Disordered" TOPO_DOM /note="Cytoplasmic" REGION /note="Disordered" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
461 | N | - | - | - | - | N |
REGION /note="Disordered" TOPO_DOM /note="Cytoplasmic" REGION /note="Disordered" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
462 | T | - | - | - | - | RT |
REGION /note="Disordered" TOPO_DOM /note="Cytoplasmic" REGION /note="Disordered" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
463 | D | - | - | - | - | D |
REGION /note="Disordered" TOPO_DOM /note="Cytoplasmic" REGION /note="Disordered" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
464 | Y | - | - | - | - | Y |
REGION /note="Disordered" TOPO_DOM /note="Cytoplasmic" REGION /note="Disordered" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
465 | F | - | - | - | - | FL |
REGION /note="Disordered" TOPO_DOM /note="Cytoplasmic" REGION /note="Disordered" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
466 | F | - | - | - | - | F |
REGION /note="Disordered" TOPO_DOM /note="Cytoplasmic" REGION /note="Disordered" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
467 | P | - | - | - | - | P |
REGION /note="Disordered" TOPO_DOM /note="Cytoplasmic" REGION /note="Disordered" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
468 | R | - | - | - | - | R |
REGION /note="Disordered" TOPO_DOM /note="Cytoplasmic" REGION /note="Disordered" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" |