Contact Molecules for Homologous Proteins
[Summary Bars]	[Full Bars]	Site Table[0.0 %]	[Back to Search Page]	[Back to HOMCOS]
[Sites by Variants]	[SupCon3D]	[help]	seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]	[show] [download] [help]

PID	QueryLength	Homolgous Sequence in PDB	UniProt Query	TITLE
2624989	215	83	P09429(HMGB1_HUMAN)	RecName: Full=High mobility group protein B1;AltName: Full=High mobility group protein 1; Short=HMG-1;
QUERYSEQ	MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAK LKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEEDEEDEEDEEEEEDEEDEDEEEDDDDE

  [n]:site number of query sequence.  [a]:amino acid of query sequence.  [s]:predicted secondary structure.
  [e]:predicted exposed/buried.  [acc]:predicted relative accesssibility(%).  [pdb]:PDB code of homologous structure.
  [contact_mols]:predicted binding molecules  [observed aa]:Observed amino acids among homologous sequences.  [feature table]:UniProt Feature Table
  [variant]:UniProt Human Variant.

n	a	s	e	acc	pdb	contact_mols	observed aa	feature table	variant
1	M	S	e	77.8	2yrq_A		ML	BINDING /ligand="heparin" /ligand_id="ChEBI:CHEBI:28304" REGION /note="Sufficient for interaction with HAVCR2" BINDING /ligand="heparin" /ligand_id="ChEBI:CHEBI:28304" DISORDER predicted by DISOPRED REGION /note="Sufficient for interaction with HAVCR2"
2	G	S	e	73.8	2yrq_A		GAIK	BINDING /ligand="heparin" /ligand_id="ChEBI:CHEBI:28304" REGION /note="Sufficient for interaction with HAVCR2" BINDING /ligand="heparin" /ligand_id="ChEBI:CHEBI:28304" DISORDER predicted by DISOPRED REGION /note="Sufficient for interaction with HAVCR2"
3	K	S	e	88.2	2yrq_A		KE	MOD_RES /note="N6-acetyllysine" BINDING /ligand="heparin" /ligand_id="ChEBI:CHEBI:28304" REGION /note="LPS binding (delipidated)" REGION /note="Sufficient for interaction with HAVCR2" MOD_RES /note="N6-acetyllysine" BINDING /ligand="heparin" /ligand_id="ChEBI:CHEBI:28304" REGION /note="LPS binding (delipidated)" DISORDER predicted by DISOPRED REGION /note="Sufficient for interaction with HAVCR2"
4	G		e	63.1	2yrq_A		KGQRNE	BINDING /ligand="heparin" /ligand_id="ChEBI:CHEBI:28304" REGION /note="LPS binding (delipidated)" REGION /note="Sufficient for interaction with HAVCR2" BINDING /ligand="heparin" /ligand_id="ChEBI:CHEBI:28304" REGION /note="LPS binding (delipidated)" DISORDER predicted by DISOPRED REGION /note="Sufficient for interaction with HAVCR2"
5	D		e	63.0	2yrq_A		DGLFYI	BINDING /ligand="heparin" /ligand_id="ChEBI:CHEBI:28304" REGION /note="LPS binding (delipidated)" REGION /note="Sufficient for interaction with HAVCR2" BINDING /ligand="heparin" /ligand_id="ChEBI:CHEBI:28304" REGION /note="LPS binding (delipidated)" DISORDER predicted by DISOPRED REGION /note="Sufficient for interaction with HAVCR2"
6	P	S	e	84.5	2yrq_A	hetero P53_HUMAN	PSQETN	BINDING /ligand="heparin" /ligand_id="ChEBI:CHEBI:28304" REGION /note="LPS binding (delipidated)" REGION /note="Sufficient for interaction with HAVCR2" BINDING /ligand="heparin" /ligand_id="ChEBI:CHEBI:28304" REGION /note="LPS binding (delipidated)" DISORDER predicted by DISOPRED REGION /note="Sufficient for interaction with HAVCR2"
7	K	S	e	62.3	2yrq_A	hetero P53_HUMAN nucleotide precipitant	NKLEDAHPSGR	MOD_RES /note="N6-acetyllysine" BINDING /ligand="heparin" /ligand_id="ChEBI:CHEBI:28304" REGION /note="LPS binding (delipidated)" REGION /note="Sufficient for interaction with HAVCR2" MOD_RES /note="N6-acetyllysine" BINDING /ligand="heparin" /ligand_id="ChEBI:CHEBI:28304" REGION /note="LPS binding (delipidated)" DISORDER predicted by DISOPRED REGION /note="Sufficient for interaction with HAVCR2"
8	K	S	e	47.2	2yrq_A	hetero P53_HUMAN nucleotide homo precipitant	KARGPYET	MOD_RES /note="N6-acetyllysine" BINDING /ligand="heparin" /ligand_id="ChEBI:CHEBI:28304" REGION /note="LPS binding (delipidated)" REGION /note="Sufficient for interaction with HAVCR2" MOD_RES /note="N6-acetyllysine" BINDING /ligand="heparin" /ligand_id="ChEBI:CHEBI:28304" REGION /note="LPS binding (delipidated)" DISORDER predicted by DISOPRED REGION /note="Sufficient for interaction with HAVCR2"
9	P		b	11.6	2yrq_A	nucleotide	P	BINDING /ligand="heparin" /ligand_id="ChEBI:CHEBI:28304" REGION /note="LPS binding (delipidated)" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" BINDING /ligand="heparin" /ligand_id="ChEBI:CHEBI:28304" REGION /note="LPS binding (delipidated)" DISORDER predicted by DISOPRED DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2"
10	R		e	60.9	2yrq_A	hetero P53_HUMAN nucleotide	KRSADEGILNPQTV	SITE /note="Cleavage; by thrombin:thrombomodulin" BINDING /ligand="heparin" /ligand_id="ChEBI:CHEBI:28304" REGION /note="LPS binding (delipidated)" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" SITE /note="Cleavage; by thrombin:thrombomodulin" BINDING /ligand="heparin" /ligand_id="ChEBI:CHEBI:28304" REGION /note="LPS binding (delipidated)" DISORDER predicted by DISOPRED DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2"
11	G		e	23.8	2yrq_A	nucleotide	RGAPHQSVDEFIKLNT	SITE /note="Cleavage; by thrombin:thrombomodulin" REGION /note="LPS binding (delipidated)" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" SITE /note="Cleavage; by thrombin:thrombomodulin" REGION /note="LPS binding (delipidated)" DISORDER predicted by DISOPRED DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2"	G->R:(51.0 %):US Gastric-carcinoma cell line
12	K		b	19.8	2yrq_A	nucleotide	PANKGRSYDEFILQTV	MOD_RES /note="N6-acetyllysine" REGION /note="LPS binding (delipidated)" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" MOD_RES /note="N6-acetyllysine" REGION /note="LPS binding (delipidated)" DISORDER predicted by DISOPRED DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2"
13	M		b	11.6	2yrq_A	hetero P53_HUMAN nucleotide	MLVPTKRAIS	REGION /note="LPS binding (delipidated)" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" REGION /note="LPS binding (delipidated)" DISORDER predicted by DISOPRED DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2"
14	S		e	50.0	2yrq_A	nucleotide	ST	REGION /note="LPS binding (delipidated)" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" REGION /note="LPS binding (delipidated)" DISORDER predicted by DISOPRED DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2"
15	S	H	b	13.3	2yrq_A	nucleotide	ASGP	REGION /note="LPS binding (delipidated)" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" REGION /note="LPS binding (delipidated)" DISORDER predicted by DISOPRED DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2"
16	Y	H	e	21.7	2yrq_A	hetero P53_HUMAN nucleotide	YFM	DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" DISORDER predicted by DISOPRED DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2"
17	A	H	e	29.5	2yrq_A	hetero P53_HUMAN nucleotide	MFLAVING	DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2"
18	F	H	b	17.7	2yrq_A	nucleotide	FLVRIYH	DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2"
19	F	H	b	0.0	2yrq_A	nucleotide	FWYL	DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2"
20	V	H	b	16.7	2yrq_A	hetero P53_HUMAN nucleotide	SVLAMCFK	DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2"
21	Q	H	e	45.9	2yrq_A	hetero P53_HUMAN nucleotide	QNEKADLMGTI	DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2"
22	T	H	e	34.4	2yrq_A		EDATSHMNP	DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2"
23	C	H	b	16.0	2yrq_A	nucleotide	NCFQKRHISEYALM	MOD_RES /note="Cysteine sulfonic acid (-SO3H); alternate" DISULFID /note="In disulfide HMGB1; alternate" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" MOD_RES /note="Cysteine sulfonic acid (-SO3H); alternate" DISULFID /note="In disulfide HMGB1; alternate" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2"
24	R	H	e	47.4	2yrq_A	hetero P53_HUMAN nucleotide	RLYH	DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2"
25	E	H	e	48.7	2yrq_A		EDNPAKRSVCGQ	DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2"
26	E	H	e	60.8	2yrq_A	nucleotide	EQKINSVRTA	DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2"
27	H	H	b	12.6	2yrq_A	nucleotide	ILFHVYMN	MOTIF /note="Nuclear localization signal (NLS) 1" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" MOTIF /note="Nuclear localization signal (NLS) 1" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2"
28	K	H	e	51.4	2yrq_A	hetero P53_HUMAN nucleotide	KRVQGILN	MOD_RES /note="N6-acetyllysine" CROSSLNK /note="Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-?)" MOTIF /note="Nuclear localization signal (NLS) 1" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" MOD_RES /note="N6-acetyllysine" CROSSLNK /note="Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-?)" DISORDER predicted by DISOPRED MOTIF /note="Nuclear localization signal (NLS) 1" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2"
29	K	H	e	83.0	2yrq_A	precipitant	KAESTNQGR	MOD_RES /note="N6-acetyllysine" MOTIF /note="Nuclear localization signal (NLS) 1" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" MOD_RES /note="N6-acetyllysine" MOTIF /note="Nuclear localization signal (NLS) 1" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2"
30	K	H	e	73.1	2yrq_A	nucleotide precipitant	EKDQSALNRT	MOD_RES /note="N6-acetyllysine" MOTIF /note="Nuclear localization signal (NLS) 1" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" MOD_RES /note="N6-acetyllysine" DISORDER predicted by DISOPRED MOTIF /note="Nuclear localization signal (NLS) 1" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2"
31	H		e	51.3	2yrq_A		NHRYQMFG	MOTIF /note="Nuclear localization signal (NLS) 1" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" DISORDER predicted by DISOPRED MOTIF /note="Nuclear localization signal (NLS) 1" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2"
32	P	T	e	75.2	2yrq_A	precipitant	PDKS	MOTIF /note="Nuclear localization signal (NLS) 1" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" DISORDER predicted by DISOPRED MOTIF /note="Nuclear localization signal (NLS) 1" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2"
33	D	T	e	97.5	2yrq_A		DNEGKALFIPQRSTVY	MOTIF /note="Nuclear localization signal (NLS) 1" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" DISORDER predicted by DISOPRED MOTIF /note="Nuclear localization signal (NLS) 1" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2"
34	A		e	30.4	2yrq_A		AILVKSTCEFNDGPRHMQY	MOTIF /note="Nuclear localization signal (NLS) 1" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" DISORDER predicted by DISOPRED MOTIF /note="Nuclear localization signal (NLS) 1" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2"
35	S		e	89.8	2yrq_A	hetero P53_HUMAN nucleotide homo	KSGTNPEYADFILQRV	MOD_RES /note="Phosphoserine" ECO:0007744|PubMed:20068231, ECO:0007744|PubMed:21406692, ECO:0007744|PubMed:23186163" MUTAGEN /note="S->A: Greatly reduces phosphorylation, nuclear localization; when associated with A-39; A-42; A-46; A-53 and A-181." MUTAGEN /note="S->E: Cytoplasmic localization (phosphorylation mimicking); when associated with E-39; E-42; E-46; E-53 and E-181." MOTIF /note="Nuclear localization signal (NLS) 1" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" MOD_RES /note="Phosphoserine" ECO:0007744|PubMed:20068231, ECO:0007744|PubMed:21406692, ECO:0007744|PubMed:23186163" MUTAGEN /note="S->A: Greatly reduces phosphorylation, nuclear localization; when associated with A-39; A-42; A-46; A-53 and A-181." MUTAGEN /note="S->E: Cytoplasmic localization (phosphorylation mimicking); when associated with E-39; E-42; E-46; E-53 and E-181." DISORDER predicted by DISOPRED MOTIF /note="Nuclear localization signal (NLS) 1" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2"
36	V		e	47.3	2yrq_A	hetero P53_HUMAN nucleotide	VILEKPAMNTDFGQRSY	MOTIF /note="Nuclear localization signal (NLS) 1" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" DISORDER predicted by DISOPRED MOTIF /note="Nuclear localization signal (NLS) 1" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2"
37	N		e	53.9	2yrq_A	nucleotide homo	SNPQRGTAKDHILEVCFMWY	MOTIF /note="Nuclear localization signal (NLS) 1" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" DISORDER predicted by DISOPRED MOTIF /note="Nuclear localization signal (NLS) 1" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2"
38	F	H	e	75.6	2yrq_A	hetero P53_HUMAN nucleotide homo	FVNLPAMDEGIKRSTCHQY	MOTIF /note="Nuclear localization signal (NLS) 1" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" MOTIF /note="Nuclear localization signal (NLS) 1" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2"
39	S	H	e	53.1	2yrq_A	hetero P53_HUMAN nucleotide	SGTAPRKIVL	MUTAGEN /note="S->A: Greatly reduces phosphorylation, nuclear localization; when associated with A-35; A-42; A-46; A-53 and A-181." MUTAGEN /note="S->E: Cytoplasmic localization (phosphorylation mimicking); when associated with E-35; E-42; E-46; E-53 and E-181." MOTIF /note="Nuclear localization signal (NLS) 1" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" MUTAGEN /note="S->A: Greatly reduces phosphorylation, nuclear localization; when associated with A-35; A-42; A-46; A-53 and A-181." MUTAGEN /note="S->E: Cytoplasmic localization (phosphorylation mimicking); when associated with E-35; E-42; E-46; E-53 and E-181." MOTIF /note="Nuclear localization signal (NLS) 1" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2"
40	E	H	e	52.8	2yrq_A	nucleotide	EQADV	MOTIF /note="Nuclear localization signal (NLS) 1" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" MOTIF /note="Nuclear localization signal (NLS) 1" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2"
41	F	H	b	10.0	2yrq_A	nucleotide	VILF	MOTIF /note="Nuclear localization signal (NLS) 1" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" MOTIF /note="Nuclear localization signal (NLS) 1" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2"
42	S	H	e	43.8	2yrq_A	hetero P53_HUMAN nucleotide	GSTAINLM	MUTAGEN /note="S->A: Greatly reduces phosphorylation, nuclear localization; when associated with A-35; A-39; A-46; A-53 and A-181." MUTAGEN /note="S->E: Cytoplasmic localization (phosphorylation mimicking); when associated with E-35; E-39; E-46; E-53 and E-181." MOTIF /note="Nuclear localization signal (NLS) 1" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" MUTAGEN /note="S->A: Greatly reduces phosphorylation, nuclear localization; when associated with A-35; A-39; A-46; A-53 and A-181." MUTAGEN /note="S->E: Cytoplasmic localization (phosphorylation mimicking); when associated with E-35; E-39; E-46; E-53 and E-181." MOTIF /note="Nuclear localization signal (NLS) 1" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2"
43	K	H	e	67.9	2yrq_A	nucleotide	KRSQVN	MOD_RES /note="N6-acetyllysine" CROSSLNK /note="Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-?)" MOTIF /note="Nuclear localization signal (NLS) 1" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" MOD_RES /note="N6-acetyllysine" CROSSLNK /note="Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-?)" MOTIF /note="Nuclear localization signal (NLS) 1" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2"
44	K	H	e	50.0	2yrq_A		KLMAITHVD	CROSSLNK /note="Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-?)" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" CROSSLNK /note="Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-?)" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2"
45	C	H	b	0.0	2yrq_A	nucleotide	LCIAGVT	MOD_RES /note="Cysteine sulfonic acid (-SO3H); alternate" DISULFID /note="In disulfide HMGB1; alternate" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" MOD_RES /note="Cysteine sulfonic acid (-SO3H); alternate" DISULFID /note="In disulfide HMGB1; alternate" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2"
46	S	H	e	47.7	2yrq_A	hetero P53_HUMAN nucleotide	GSAQR	MUTAGEN /note="S->A: Greatly reduces phosphorylation, nuclear localization; when associated with A-35; A-39; A-42; A-53 and A-181." MUTAGEN /note="S->E: Cytoplasmic localization (phosphorylation mimicking); when associated with E-35; E-39; E-42; E-53 and E-181." DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" MUTAGEN /note="S->A: Greatly reduces phosphorylation, nuclear localization; when associated with A-35; A-39; A-42; A-53 and A-181." MUTAGEN /note="S->E: Cytoplasmic localization (phosphorylation mimicking); when associated with E-35; E-39; E-42; E-53 and E-181." DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2"
47	E	H	e	58.8	2yrq_A	nucleotide	EAQKRCDISN	DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2"
48	R	H	e	51.0	2yrq_A		KREMLDIQSA	DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2"
49	W	H	b	14.7	2yrq_A	nucleotide	WY	DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2"
50	K	H	e	68.9	2yrq_A	nucleotide	KRSNQA	DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2"
51	T	H	e	74.7	2yrq_A		EATKNSDGLHQ	DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2"
52	M	S	b	8.7	2yrq_A		LMIVA	DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2"
53	S		e	62.5	2yrq_A		STPENVFGQ	MUTAGEN /note="S->A: Greatly reduces phosphorylation, nuclear localization; when associated with A-35; A-39; A-42; A-46 and A-181." MUTAGEN /note="S->E: Cytoplasmic localization (phosphorylation mimicking); when associated with E-35; E-39; E-42; E-46 and E-181." DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" MUTAGEN /note="S->A: Greatly reduces phosphorylation, nuclear localization; when associated with A-35; A-39; A-42; A-46 and A-181." MUTAGEN /note="S->E: Cytoplasmic localization (phosphorylation mimicking); when associated with E-35; E-39; E-42; E-46 and E-181." DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2"
54	A	H	e	74.1	2yrq_A		AEDKNPSTQGLRY	DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2"
55	K	H	e	87.7	2yrq_A		KEDANSHT	DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2"
56	E	H	e	45.7	2yrq_A		EDKQYIVG	DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2"
57	K	H	e	25.5	2yrq_A		KR	DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2"
58	G	H	e	41.7	2yrq_A		KAEGSQNRDVMIL	DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2"
59	K	H	e	44.8	2yrq_A		KPREVHIAQ	DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2"
60	F	H	b	2.9	2yrq_A		YFLW	DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2"
61	E	H	e	52.8	2yrq_A	nucleotide	EQDYHILNVKR	DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2"
62	D	H	e	60.5	2yrq_A		DAEKRSQGNTV	DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2"
63	M	H	e	35.7	2yrq_A		KMLEQRAIVD	DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2"
64	A	H	b	4.5	2yrq_A	nucleotide	ASFRVYCEQG	DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2"
65	K	H	e	60.4	2yrq_A		KADEQRLNTSVM	DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2"
66	A	H	e	50.0	2yrq_A		AKEQTDNRLVGS	DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2"
67	D	H	b	4.9	2yrq_A	precipitant	DAELKNRM	MUTAGEN /note="D->A: Abolishes cleavage by CASP1 and impairs ability to antagonize apoptosis-induced immune tolerance." SITE /note="Cleavage; by CASP1" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" MUTAGEN /note="D->A: Abolishes cleavage by CASP1 and impairs ability to antagonize apoptosis-induced immune tolerance." SITE /note="Cleavage; by CASP1" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2"
68	K	H	e	46.2	2yrq_A	nucleotide precipitant	KWRATEY	CROSSLNK /note="Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-?)" SITE /note="Cleavage; by CASP1" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" CROSSLNK /note="Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-?)" SITE /note="Cleavage; by CASP1" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2"
69	A	H	e	50.9	2yrq_A		EKAQTVRGSL	DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2"
70	R	H	e	71.5	2yrq_A	precipitant	REKSDQVHNITAGL	DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2"
71	Y	T	b	7.8	2yrq_A	nucleotide precipitant	YFTASWGL	DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2"
72	E	H	e	55.8	2yrq_A	nucleotide precipitant	EKDQLMRHTINAGSV	DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2"
73	R	H	e	96.0	2yrq_A	precipitant	RKEQADVLSIG	DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2"
74	E	H	e	44.2	2yrq_A	precipitant	EAKDTSNQRGL	DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2"
75	M	H	e	30.0	2yrq_A	precipitant	MLKIVTNSRADEGPQ	DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2"
76	K	H	e	72.2	2yrq_A	precipitant	KQAELSMRNDTGIPV	COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2"
77	T	H	e	67.5	2yrq_A	precipitant	EASNTDKLVGPQRI	COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2"
78	Y		e	21.7	2yrq_A	nucleotide	YFRSHKADEGILNPQTV	COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2"
79	I		e	119.3	2yrq_A		AEFGIKLMPTVS	COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2"
80	P		e	46.5	2yrq_A	nucleotide homo	PRGEKADNSFQTLV	REGION /note="LPS binding (Lipid A)" COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Sufficient for interaction with HAVCR2" DISORDER predicted by DISOPRED REGION /note="LPS binding (Lipid A)" COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Sufficient for interaction with HAVCR2"
81	P		e	83.7	2yrq_A	precipitant	KPYSTGQRVADEL	REGION /note="LPS binding (Lipid A)" COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Sufficient for interaction with HAVCR2" DISORDER predicted by DISOPRED REGION /note="LPS binding (Lipid A)" COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Sufficient for interaction with HAVCR2"
82	K		e	92.9	2yrq_A	nucleotide precipitant	AGKLQRSTDEIPV	REGION /note="LPS binding (Lipid A)" COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Sufficient for interaction with HAVCR2" DISORDER predicted by DISOPRED REGION /note="LPS binding (Lipid A)" COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Sufficient for interaction with HAVCR2"
83	G		e	76.2	2yrq_A	nucleotide	GAEKPDRSVL	REGION /note="LPS binding (Lipid A)" COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Sufficient for interaction with HAVCR2" DISORDER predicted by DISOPRED REGION /note="LPS binding (Lipid A)" COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Sufficient for interaction with HAVCR2"
84	E		e	56.8	2yrq_A	nucleotide	EKLADRGQSNIPTV	REGION /note="LPS binding (Lipid A)" COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Sufficient for interaction with HAVCR2" DISORDER predicted by DISOPRED REGION /note="LPS binding (Lipid A)" COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Sufficient for interaction with HAVCR2"
85	T	S	e	81.2	2yrq_A	nucleotide	AEGIKLNQRSTV	REGION /note="LPS binding (Lipid A)" COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Sufficient for interaction with HAVCR2" DISORDER predicted by DISOPRED REGION /note="LPS binding (Lipid A)" COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Sufficient for interaction with HAVCR2"
86	K	S	e	85.8	2yrq_A	nucleotide	KREGSNQYAT	REGION /note="LPS binding (Lipid A)" COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Sufficient for interaction with HAVCR2" DISORDER predicted by DISOPRED REGION /note="LPS binding (Lipid A)" COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Sufficient for interaction with HAVCR2"
87	K		e	61.8	2yrq_A	hetero RAG1_MOUSE nucleotide	KREYGSDLTA	REGION /note="LPS binding (Lipid A)" COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Sufficient for interaction with HAVCR2" DISORDER predicted by DISOPRED REGION /note="LPS binding (Lipid A)" COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Sufficient for interaction with HAVCR2"
88	K	S	e	67.5	2yrq_A	nucleotide	KRAQSTEPINGL	REGION /note="LPS binding (Lipid A)" COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Sufficient for interaction with HAVCR2" DISORDER predicted by DISOPRED REGION /note="LPS binding (Lipid A)" COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Sufficient for interaction with HAVCR2"
89	F		e	69.9	2yrq_A		KLGAEFTVISNPYR	REGION /note="LPS binding (Lipid A)" COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Cytokine-stimulating activity" REGION /note="Sufficient for interaction with HAVCR2" DISORDER predicted by DISOPRED REGION /note="LPS binding (Lipid A)" COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Cytokine-stimulating activity" REGION /note="Sufficient for interaction with HAVCR2"
90	K		e	66.0	2yrq_A	hetero RAG1_MOUSE nucleotide precipitant	KRTEILNADHS	MOD_RES /note="N6-acetyllysine" REGION /note="LPS binding (Lipid A)" COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Cytokine-stimulating activity" REGION /note="Sufficient for interaction with HAVCR2" MOD_RES /note="N6-acetyllysine" DISORDER predicted by DISOPRED REGION /note="LPS binding (Lipid A)" COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Cytokine-stimulating activity" REGION /note="Sufficient for interaction with HAVCR2"
91	D		e	46.3	2yrq_A	hetero RPOM_HUMAN RAG1_MOUSE nucleotide	DLKMSETVAH	REGION /note="LPS binding (Lipid A)" COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Cytokine-stimulating activity" REGION /note="Sufficient for interaction with HAVCR2" DISORDER predicted by DISOPRED REGION /note="LPS binding (Lipid A)" COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Cytokine-stimulating activity" REGION /note="Sufficient for interaction with HAVCR2"
92	P	S	e	89.9	2yrq_A	hetero RPOM_HUMAN	PLSEKGNT	REGION /note="LPS binding (Lipid A)" COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Cytokine-stimulating activity" REGION /note="Sufficient for interaction with HAVCR2" DISORDER predicted by DISOPRED REGION /note="LPS binding (Lipid A)" COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Cytokine-stimulating activity" REGION /note="Sufficient for interaction with HAVCR2"
93	N	S	e	96.4	2yrq_A	hetero RPOM_HUMAN	NGESDAHLPVKQ	REGION /note="LPS binding (Lipid A)" COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Cytokine-stimulating activity" REGION /note="Sufficient for interaction with HAVCR2" DISORDER predicted by DISOPRED REGION /note="LPS binding (Lipid A)" COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Cytokine-stimulating activity" REGION /note="Sufficient for interaction with HAVCR2"
94	A	S	e	23.2	2yrq_A	hetero RPOM_HUMAN precipitant	AKSEHPVMQGRT	REGION /note="LPS binding (Lipid A)" COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Cytokine-stimulating activity" REGION /note="Sufficient for interaction with HAVCR2" DISORDER predicted by DISOPRED REGION /note="LPS binding (Lipid A)" COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Cytokine-stimulating activity" REGION /note="Sufficient for interaction with HAVCR2"
95	P		e	23.3	2yrq_A	nucleotide precipitant	PILRV	REGION /note="LPS binding (Lipid A)" REGION /note="Disordered" REGION /note="Cytokine-stimulating activity" DNA_BIND /note="HMG box 2" REGION /note="Sufficient for interaction with HAVCR2" DISORDER predicted by DISOPRED REGION /note="LPS binding (Lipid A)" REGION /note="Disordered" REGION /note="Cytokine-stimulating activity" DNA_BIND /note="HMG box 2" REGION /note="Sufficient for interaction with HAVCR2"
96	K		e	61.8	2yrq_A	hetero RPOM_HUMAN nucleotide homo precipitant	KRQ	REGION /note="LPS binding (Lipid A)" REGION /note="Cytokine-stimulating activity" DNA_BIND /note="HMG box 2" REGION /note="Sufficient for interaction with HAVCR2" REGION /note="LPS binding (Lipid A)" REGION /note="Cytokine-stimulating activity" DNA_BIND /note="HMG box 2" REGION /note="Sufficient for interaction with HAVCR2"
97	R		e	64.0	2yrq_A	nucleotide homo	RKSAIP	REGION /note="Cytokine-stimulating activity" DNA_BIND /note="HMG box 2" REGION /note="Sufficient for interaction with HAVCR2" REGION /note="Cytokine-stimulating activity" DNA_BIND /note="HMG box 2" REGION /note="Sufficient for interaction with HAVCR2"
98	P		e	26.4	2yrq_A	nucleotide homo precipitant	PANQGISY	REGION /note="Cytokine-stimulating activity" DNA_BIND /note="HMG box 2" REGION /note="Cytokine-stimulating activity" DNA_BIND /note="HMG box 2"
99	P		e	31.8	2yrq_A	hetero RPOM_HUMAN nucleotide homo precipitant	LMPRTEVSIAQ	REGION /note="Cytokine-stimulating activity" DNA_BIND /note="HMG box 2" REGION /note="Cytokine-stimulating activity" DNA_BIND /note="HMG box 2"
100	S		e	49.2	2yrq_A	nucleotide precipitant	STNEGAL	MOD_RES /note="Phosphoserine" REGION /note="Cytokine-stimulating activity" DNA_BIND /note="HMG box 2" MOD_RES /note="Phosphoserine" REGION /note="Cytokine-stimulating activity" DNA_BIND /note="HMG box 2"
101	A	H	b	0.0	2yrq_A	nucleotide	AGSIPM	REGION /note="Cytokine-stimulating activity" DNA_BIND /note="HMG box 2" REGION /note="Cytokine-stimulating activity" DNA_BIND /note="HMG box 2"
102	F	H	e	39.2	2yrq_A	hetero RAGE_HUMAN nucleotide	FYML	REGION /note="Cytokine-stimulating activity" DNA_BIND /note="HMG box 2" REGION /note="Cytokine-stimulating activity" DNA_BIND /note="HMG box 2"
103	F	H	e	48.8	2yrq_A	nucleotide precipitant	FMNLIVAQ	REGION /note="Cytokine-stimulating activity" DNA_BIND /note="HMG box 2" REGION /note="Cytokine-stimulating activity" DNA_BIND /note="HMG box 2"
104	L	H	e	21.3	2yrq_A	hetero RPOM_HUMAN homo	LFVIRQYW	REGION /note="Cytokine-stimulating activity" DNA_BIND /note="HMG box 2" REGION /note="Cytokine-stimulating activity" DNA_BIND /note="HMG box 2"
105	F	H	b	1.9	2yrq_A	hetero RAGE_HUMAN	FWYL	REGION /note="Cytokine-stimulating activity" DNA_BIND /note="HMG box 2" REGION /note="Cytokine-stimulating activity" DNA_BIND /note="HMG box 2"
106	C	H	b	8.7	2yrq_A	nucleotide precipitant	SCLAMVFIKQTY	MOD_RES /note="Cysteine sulfonic acid (-SO3H)" MUTAGEN /note="C->S: Inhibits oxidation-dependent inactivation of immunostimmulatory activity in apoptotic cells." REGION /note="Cytokine-stimulating activity" DNA_BIND /note="HMG box 2" MOD_RES /note="Cysteine sulfonic acid (-SO3H)" MUTAGEN /note="C->S: Inhibits oxidation-dependent inactivation of immunostimmulatory activity in apoptotic cells." REGION /note="Cytokine-stimulating activity" DNA_BIND /note="HMG box 2"
107	S	H	e	31.2	2yrq_A	hetero RPOM_HUMAN nucleotide precipitant	QNSKAERDGMYIL	REGION /note="Cytokine-stimulating activity" DNA_BIND /note="HMG box 2" REGION /note="Cytokine-stimulating activity" DNA_BIND /note="HMG box 2"
108	E	H	e	52.3	2yrq_A	hetero RPOM_HUMAN	EDAMINHRSTL	REGION /note="Cytokine-stimulating activity" DNA_BIND /note="HMG box 2" REGION /note="Cytokine-stimulating activity" DNA_BIND /note="HMG box 2"
109	Y	H	e	33.0	2yrq_A		ENFQHARWYKLSTVIM	DNA_BIND /note="HMG box 2" DNA_BIND /note="HMG box 2"
110	R	H	e	46.2	2yrq_A	nucleotide precipitant	RQFYSHK	DNA_BIND /note="HMG box 2" DNA_BIND /note="HMG box 2"
111	P	H	e	60.5	2yrq_A	nucleotide	EQAPKRSVDGN	DNA_BIND /note="HMG box 2" DNA_BIND /note="HMG box 2"
112	K	H	e	58.5	2yrq_A		KQSERNTAIVLM	DNA_BIND /note="HMG box 2" DNA_BIND /note="HMG box 2"
113	I	H	e	21.1	2yrq_A		IVLFAMYR	DNA_BIND /note="HMG box 2" DNA_BIND /note="HMG box 2"
114	K	H	e	41.5	2yrq_A	nucleotide	KRIAQMVLNCT	DNA_BIND /note="HMG box 2" DNA_BIND /note="HMG box 2"
115	G	H	e	70.2	2yrq_A	nucleotide homo	AGEKDSTQLNRP	DNA_BIND /note="HMG box 2" DNA_BIND /note="HMG box 2"
116	E	H	e	78.4	2yrq_A	homo	EDQKAGLSRNTV	DNA_BIND /note="HMG box 2" DNA_BIND /note="HMG box 2"
117	H		e	45.0	2yrq_A		NHYRCLPFKTWS	DNA_BIND /note="HMG box 2" DNA_BIND /note="HMG box 2"
118	P	S	e	85.3	2yrq_A	nucleotide homo	PLSADGKN	DNA_BIND /note="HMG box 2" DNA_BIND /note="HMG box 2"
119	G	S	e	86.9	2yrq_A	nucleotide homo	GDNAESTHQR	DNA_BIND /note="HMG box 2" DNA_BIND /note="HMG box 2"
120	L	S	e	32.0	2yrq_A	nucleotide	LIVRAKMWTQFNSYCD	DNA_BIND /note="HMG box 2" DNA_BIND /note="HMG box 2"
121	S		e	50.8	2yrq_A	nucleotide	SKTHDFPAGNRL	DNA_BIND /note="HMG box 2" DNA_BIND /note="HMG box 2"
122	I	H	e	95.9	2yrq_A	nucleotide precipitant	VFNIKALTQEMP	DNA_BIND /note="HMG box 2" DNA_BIND /note="HMG box 2"
123	G	H	e	48.8	2yrq_A	nucleotide	GATSPNVKIRQD	DNA_BIND /note="HMG box 2" DNA_BIND /note="HMG box 2"
124	D	H	e	57.4	2yrq_A		EDQKAGTSNV	DNA_BIND /note="HMG box 2" DNA_BIND /note="HMG box 2"
125	V	H	b	0.7	2yrq_A		VILRAMKT	DNA_BIND /note="HMG box 2" DNA_BIND /note="HMG box 2"
126	A	H	e	29.5	2yrq_A	nucleotide precipitant	SAGTVLNPI	DNA_BIND /note="HMG box 2" DNA_BIND /note="HMG box 2"
127	K	H	e	80.2	2yrq_A	nucleotide	KRSAQ	MOD_RES /note="N6-acetyllysine" DNA_BIND /note="HMG box 2" MOD_RES /note="N6-acetyllysine" DNA_BIND /note="HMG box 2"
128	K	H	e	40.6	2yrq_A		AKILMTENRVDHQS	MOD_RES /note="N6-acetyllysine" DNA_BIND /note="HMG box 2" MOD_RES /note="N6-acetyllysine" DNA_BIND /note="HMG box 2"
129	L	H	b	1.1	2yrq_A		LIAVGMFCST	DNA_BIND /note="HMG box 2" DNA_BIND /note="HMG box 2"
130	G	H	e	28.6	2yrq_A	nucleotide	GAKNSHV	DNA_BIND /note="HMG box 2" DNA_BIND /note="HMG box 2"
131	E	H	e	45.2	2yrq_A	nucleotide	EAKDQRSNGLITVY	DNA_BIND /note="HMG box 2" DNA_BIND /note="HMG box 2"
132	M	H	e	25.6	2yrq_A		MKREALNDGWIPQV	DNA_BIND /note="HMG box 2" DNA_BIND /note="HMG box 2"
133	W	H	b	9.2	2yrq_A	nucleotide	WFYC	DNA_BIND /note="HMG box 2" DNA_BIND /note="HMG box 2"
134	N	H	e	91.5	2yrq_A	nucleotide metal NA homo	KNRSQDAGTM	DNA_BIND /note="HMG box 2" DNA_BIND /note="HMG box 2"
135	N	H	e	89.7	2yrq_A		NSEKALDTGQVHM	DNA_BIND /note="HMG box 2" DNA_BIND /note="HMG box 2"
136	T	S	e	20.1	2yrq_A		LMVITCQYAK	DNA_BIND /note="HMG box 2" DNA_BIND /note="HMG box 2"
137	A		e	42.9	2yrq_A	homo	STPEGANDKQL	DNA_BIND /note="HMG box 2" DNA_BIND /note="HMG box 2"
138	A	G	e	67.9	2yrq_A	homo	EADKPQGLNSHIMRTY	DNA_BIND /note="HMG box 2" DNA_BIND /note="HMG box 2"
139	D	G	e	82.7	2yrq_A	hetero RAGE_HUMAN homo	EKDSANQTGRHLV	DNA_BIND /note="HMG box 2" DNA_BIND /note="HMG box 2"
140	D	G	e	49.4	2yrq_A	hetero RAGE_HUMAN homo	EDKQNTIV	DNA_BIND /note="HMG box 2" DNA_BIND /note="HMG box 2"
141	K	H	e	21.7	2yrq_A	nucleotide homo	KRPV	MOD_RES /note="N6-acetyllysine" DNA_BIND /note="HMG box 2" MOD_RES /note="N6-acetyllysine" DNA_BIND /note="HMG box 2"
142	Q	H	e	73.0	2yrq_A	hetero RAGE_HUMAN	QKALERIHSDVTW	DNA_BIND /note="HMG box 2" DNA_BIND /note="HMG box 2"
143	P	H	e	52.7	2yrq_A		PVKEMARFGHILT	DNA_BIND /note="HMG box 2" DNA_BIND /note="HMG box 2"
144	Y	H	b	19.1	2yrq_A		YWFLG	DNA_BIND /note="HMG box 2" DNA_BIND /note="HMG box 2"
145	E	H	e	52.8	2yrq_A	hetero RAGE_HUMAN nucleotide homo	EIVKYLNDFTQ	DNA_BIND /note="HMG box 2" DNA_BIND /note="HMG box 2"
146	K	H	e	64.2	2yrq_A	hetero RAGE_HUMAN	QEKDARSGTILN	DNA_BIND /note="HMG box 2" DNA_BIND /note="HMG box 2"
147	K	H	e	41.5	2yrq_A	hetero RPOM_HUMAN RAGE_HUMAN homo	KELRMAQGI	DNA_BIND /note="HMG box 2" DNA_BIND /note="HMG box 2"
148	A	H	b	10.7	2yrq_A	hetero RAGE_HUMAN nucleotide	ASYLQTERV	DNA_BIND /note="HMG box 2" DNA_BIND /note="HMG box 2"
149	A	H	e	50.9	2yrq_A	hetero RAGE_HUMAN homo	AEQKSRDVNTGILM	DNA_BIND /note="HMG box 2" DNA_BIND /note="HMG box 2"	A->E:(23.0 %):US Gastric-carcinoma cell line
150	K	H	e	68.9	2yrq_A	homo	KEARDYLVQST	REGION /note="Binding to AGER/RAGE" DNA_BIND /note="HMG box 2" REGION /note="Binding to AGER/RAGE" DNA_BIND /note="HMG box 2"
151	L	H	e	37.1	2yrq_A	homo	DLAERKMVYS	REGION /note="Binding to AGER/RAGE" DNA_BIND /note="HMG box 2" REGION /note="Binding to AGER/RAGE" DNA_BIND /note="HMG box 2"
152	K	H	e	40.6	2yrq_A	nucleotide	KRQAGMYS	REGION /note="Binding to AGER/RAGE" DNA_BIND /note="HMG box 2" REGION /note="Binding to AGER/RAGE" DNA_BIND /note="HMG box 2"
153	E	H	e	52.3	2yrq_A	hetero RAGE_HUMAN homo	EKAVDIQSLHRTGM	REGION /note="Binding to AGER/RAGE" DNA_BIND /note="HMG box 2" REGION /note="Binding to AGER/RAGE" DNA_BIND /note="HMG box 2"
154	K	H	e	69.8	2yrq_A	hetero RPOM_HUMAN RAGE_HUMAN	RKEAQDLTIN	REGION /note="Binding to AGER/RAGE" DNA_BIND /note="HMG box 2" REGION /note="Binding to AGER/RAGE" DNA_BIND /note="HMG box 2"
155	Y	H	b	14.8	2yrq_A	hetero RAGE_HUMAN nucleotide precipitant	YHFQSAW	REGION /note="Binding to AGER/RAGE" DNA_BIND /note="HMG box 2" REGION /note="Binding to AGER/RAGE" DNA_BIND /note="HMG box 2"
156	E	H	e	44.2	2yrq_A	hetero RAGE_HUMAN nucleotide	EKMDQNTYAGILFHR	REGION /note="Binding to AGER/RAGE" DNA_BIND /note="HMG box 2" REGION /note="Binding to AGER/RAGE" DNA_BIND /note="HMG box 2"	E->Q:(7.0 %):LB/B -
157	K	H	e	67.9	2yrq_A	homo	KREDNAMYISTV	REGION /note="Binding to AGER/RAGE" DNA_BIND /note="HMG box 2" REGION /note="Binding to AGER/RAGE" DNA_BIND /note="HMG box 2"
158	D	H	e	66.0	2yrq_A	hetero RPOM_HUMAN precipitant	EADNQTS	REGION /note="Binding to AGER/RAGE" DNA_BIND /note="HMG box 2" REGION /note="Binding to AGER/RAGE" DNA_BIND /note="HMG box 2"
159	I	H	b	18.1	2yrq_A	nucleotide precipitant	MLIYVHKNRSQ	REGION /note="Binding to AGER/RAGE" DNA_BIND /note="HMG box 2" REGION /note="Binding to AGER/RAGE" DNA_BIND /note="HMG box 2"
160	A	H	e	49.1	2yrq_A	precipitant	AKEPQSRTVLDW	REGION /note="Binding to AGER/RAGE" DNA_BIND /note="HMG box 2" REGION /note="Binding to AGER/RAGE" DNA_BIND /note="HMG box 2"
161	A	H	e	62.5	2yrq_A		AEDQNSGLVIK	COMPBIAS /note="Basic and acidic residues" REGION /note="Binding to AGER/RAGE" REGION /note="Disordered" DNA_BIND /note="HMG box 2" COMPBIAS /note="Basic and acidic residues" REGION /note="Binding to AGER/RAGE" REGION /note="Disordered" DNA_BIND /note="HMG box 2"
162	Y	H	e	59.1	2yrq_A		YMWLQDF	COMPBIAS /note="Basic and acidic residues" REGION /note="Binding to AGER/RAGE" REGION /note="Disordered" DNA_BIND /note="HMG box 2" COMPBIAS /note="Basic and acidic residues" REGION /note="Binding to AGER/RAGE" REGION /note="Disordered" DNA_BIND /note="HMG box 2"
163	R	H	e	56.1	2yrq_A	nucleotide	RKNEQDIS	COMPBIAS /note="Basic and acidic residues" REGION /note="Binding to AGER/RAGE" REGION /note="Disordered" DNA_BIND /note="HMG box 2" COMPBIAS /note="Basic and acidic residues" REGION /note="Binding to AGER/RAGE" REGION /note="Disordered" DNA_BIND /note="HMG box 2"
164	A		e	66.1	2yrq_A	nucleotide	AKYESGTRNQLPV	COMPBIAS /note="Basic and acidic residues" REGION /note="Binding to AGER/RAGE" REGION /note="Disordered" COMPBIAS /note="Basic and acidic residues" REGION /note="Binding to AGER/RAGE" DISORDER predicted by DISOPRED REGION /note="Disordered"
165	K		e	77.4	2yrq_A		KQRSNALEGDFIPTVY	COMPBIAS /note="Basic and acidic residues" REGION /note="Binding to AGER/RAGE" REGION /note="Disordered" COMPBIAS /note="Basic and acidic residues" REGION /note="Binding to AGER/RAGE" DISORDER predicted by DISOPRED REGION /note="Disordered"
166	G		e	147.6	2yrq_A	homo	GAKSMFPNYELVDHIQRT	COMPBIAS /note="Basic and acidic residues" REGION /note="Binding to AGER/RAGE" REGION /note="Disordered" COMPBIAS /note="Basic and acidic residues" REGION /note="Binding to AGER/RAGE" DISORDER predicted by DISOPRED REGION /note="Disordered"
167	K	T	e	39.6	1hsm_A	homo	KRGEANTPQLMDFISVY	COMPBIAS /note="Basic and acidic residues" REGION /note="Binding to AGER/RAGE" REGION /note="Disordered" COMPBIAS /note="Basic and acidic residues" REGION /note="Binding to AGER/RAGE" DISORDER predicted by DISOPRED REGION /note="Disordered"
168	P	T	e	52.7	1hsm_A	homo	PSTGEMNKVFADILQR	COMPBIAS /note="Basic and acidic residues" REGION /note="Binding to AGER/RAGE" REGION /note="Disordered" COMPBIAS /note="Basic and acidic residues" REGION /note="Binding to AGER/RAGE" DISORDER predicted by DISOPRED REGION /note="Disordered"
169	D	T	e	86.4	1hsm_A	homo	DEPRNAVTFGIKLQSY	COMPBIAS /note="Basic and acidic residues" REGION /note="Binding to AGER/RAGE" REGION /note="Disordered" COMPBIAS /note="Basic and acidic residues" REGION /note="Binding to AGER/RAGE" DISORDER predicted by DISOPRED REGION /note="Disordered"
170	A	T	b	16.1	1hsm_A		ASVLGRYDEFIKNPQT	COMPBIAS /note="Basic and acidic residues" REGION /note="Binding to AGER/RAGE" REGION /note="Disordered" COMPBIAS /note="Basic and acidic residues" REGION /note="Binding to AGER/RAGE" DISORDER predicted by DISOPRED REGION /note="Disordered"
171	A		e	110.7	1hsm_A		AGIYLSRVEDKPT	COMPBIAS /note="Basic and acidic residues" REGION /note="Binding to AGER/RAGE" REGION /note="Disordered" COMPBIAS /note="Basic and acidic residues" REGION /note="Binding to AGER/RAGE" DISORDER predicted by DISOPRED REGION /note="Disordered"
172	K		e	21.7	6hb4_A	nucleotide	KRAELQDFGINPSTV	MOD_RES /note="N6-acetyllysine" COMPBIAS /note="Basic and acidic residues" REGION /note="Binding to AGER/RAGE" REGION /note="Disordered" MOD_RES /note="N6-acetyllysine" COMPBIAS /note="Basic and acidic residues" REGION /note="Binding to AGER/RAGE" DISORDER predicted by DISOPRED REGION /note="Disordered"
173	K	S	e	90.5	6hb4_A	nucleotide precipitant	KGRIVDMQEPSTAL	MOD_RES /note="N6-acetyllysine" COMPBIAS /note="Basic and acidic residues" REGION /note="Binding to AGER/RAGE" REGION /note="Disordered" MOD_RES /note="N6-acetyllysine" COMPBIAS /note="Basic and acidic residues" REGION /note="Binding to AGER/RAGE" DISORDER predicted by DISOPRED REGION /note="Disordered"
174	G		e	64.9	6hb4_A	nucleotide precipitant	GSVATCFKYREL	COMPBIAS /note="Basic and acidic residues" REGION /note="Binding to AGER/RAGE" REGION /note="Disordered" COMPBIAS /note="Basic and acidic residues" REGION /note="Binding to AGER/RAGE" DISORDER predicted by DISOPRED REGION /note="Disordered"
175	V		b	8.2	6hb4_A	nucleotide precipitant	VAKSTIPRCEGL	COMPBIAS /note="Basic and acidic residues" REGION /note="Binding to AGER/RAGE" REGION /note="Disordered" COMPBIAS /note="Basic and acidic residues" REGION /note="Binding to AGER/RAGE" DISORDER predicted by DISOPRED REGION /note="Disordered"
176	V	T	e	54.2	6hb4_A	nucleotide	VARLEPISDGN	COMPBIAS /note="Basic and acidic residues" REGION /note="Binding to AGER/RAGE" REGION /note="Disordered" COMPBIAS /note="Basic and acidic residues" REGION /note="Binding to AGER/RAGE" DISORDER predicted by DISOPRED REGION /note="Disordered"
177	K	T	e	67.0	6hb4_A		KRTQE	MOD_RES /note="N6-acetyllysine" COMPBIAS /note="Basic and acidic residues" REGION /note="Binding to AGER/RAGE" REGION /note="Disordered" MOD_RES /note="N6-acetyllysine" COMPBIAS /note="Basic and acidic residues" REGION /note="Binding to AGER/RAGE" DISORDER predicted by DISOPRED REGION /note="Disordered"
178	A	S	e	68.4	6hb4_A		AEDKRPISVGL	MOTIF /note="Nuclear localization signal (NLS) 2" COMPBIAS /note="Basic and acidic residues" REGION /note="Binding to AGER/RAGE" REGION /note="Disordered" MOTIF /note="Nuclear localization signal (NLS) 2" COMPBIAS /note="Basic and acidic residues" REGION /note="Binding to AGER/RAGE" DISORDER predicted by DISOPRED REGION /note="Disordered"
179	E		e	79.8	6hb4_A		AEQSTMRGL	MOTIF /note="Nuclear localization signal (NLS) 2" COMPBIAS /note="Basic and acidic residues" REGION /note="Binding to AGER/RAGE" REGION /note="Disordered" MOTIF /note="Nuclear localization signal (NLS) 2" COMPBIAS /note="Basic and acidic residues" REGION /note="Binding to AGER/RAGE" DISORDER predicted by DISOPRED REGION /note="Disordered"
180	K		e	59.0	6hb4_A		KGAEDQSR	MOD_RES /note="N6-acetyllysine" CROSSLNK /note="Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-?)" MOTIF /note="Nuclear localization signal (NLS) 2" COMPBIAS /note="Basic and acidic residues" REGION /note="Binding to AGER/RAGE" REGION /note="Disordered" MOD_RES /note="N6-acetyllysine" CROSSLNK /note="Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-?)" MOTIF /note="Nuclear localization signal (NLS) 2" COMPBIAS /note="Basic and acidic residues" REGION /note="Binding to AGER/RAGE" DISORDER predicted by DISOPRED REGION /note="Disordered"
181	S	-	-	-	-		STKPRADN	MOD_RES /note="ADP-ribosylserine" MUTAGEN /note="S->A: Greatly reduces phosphorylation, nuclear localization; when associated with A-35; A-39; A-42; A-46 and A-53." MUTAGEN /note="S->E: Cytoplasmic localization (phosphorylation mimicking); when associated with E-35; E-39; E-42; E-46 and E-53." MOTIF /note="Nuclear localization signal (NLS) 2" COMPBIAS /note="Basic and acidic residues" REGION /note="Binding to AGER/RAGE" REGION /note="Disordered" MOD_RES /note="ADP-ribosylserine" MUTAGEN /note="S->A: Greatly reduces phosphorylation, nuclear localization; when associated with A-35; A-39; A-42; A-46 and A-53." MUTAGEN /note="S->E: Cytoplasmic localization (phosphorylation mimicking); when associated with E-35; E-39; E-42; E-46 and E-53." MOTIF /note="Nuclear localization signal (NLS) 2" COMPBIAS /note="Basic and acidic residues" REGION /note="Binding to AGER/RAGE" DISORDER predicted by DISOPRED REGION /note="Disordered"
182	K	-	-	-	-		KSQRGNVL	MOD_RES /note="N6-acetyllysine" CROSSLNK /note="Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-?)" MOTIF /note="Nuclear localization signal (NLS) 2" COMPBIAS /note="Basic and acidic residues" REGION /note="Binding to AGER/RAGE" REGION /note="Disordered" MOD_RES /note="N6-acetyllysine" CROSSLNK /note="Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-?)" MOTIF /note="Nuclear localization signal (NLS) 2" COMPBIAS /note="Basic and acidic residues" REGION /note="Binding to AGER/RAGE" DISORDER predicted by DISOPRED REGION /note="Disordered"
183	K	-	-	-	-		KTAEGQDIPS	MOD_RES /note="N6-acetyllysine" CROSSLNK /note="Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-?)" MOTIF /note="Nuclear localization signal (NLS) 2" COMPBIAS /note="Basic and acidic residues" REGION /note="Binding to AGER/RAGE" REGION /note="Disordered" MOD_RES /note="N6-acetyllysine" CROSSLNK /note="Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-?)" MOTIF /note="Nuclear localization signal (NLS) 2" COMPBIAS /note="Basic and acidic residues" REGION /note="Binding to AGER/RAGE" DISORDER predicted by DISOPRED REGION /note="Disordered"
184	K	-	-	-	-		KGSCNAEV	MOD_RES /note="N6-acetyllysine" CROSSLNK /note="Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-?)" MOTIF /note="Nuclear localization signal (NLS) 2" COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" MOD_RES /note="N6-acetyllysine" CROSSLNK /note="Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-?)" MOTIF /note="Nuclear localization signal (NLS) 2" COMPBIAS /note="Basic and acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered"
185	K	-	-	-	-		KEARGPISN	MOD_RES /note="N6-acetyllysine" COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" MOD_RES /note="N6-acetyllysine" COMPBIAS /note="Basic and acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered"
186	E	-	-	-	-		EQSKALNPD	COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" COMPBIAS /note="Basic and acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered"
187	E	-	-	-	-		ESDFAHQ	COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" COMPBIAS /note="Basic and acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered"
188	E	-	-	-	-		EDRTKP	COMPBIAS /note="Acidic residues" REGION /note="Disordered" COMPBIAS /note="Acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered"
189	E	-	-	-	-		QEADKSV	COMPBIAS /note="Acidic residues" REGION /note="Disordered" COMPBIAS /note="Acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered"
190	D	-	-	-	-		DEKAG	COMPBIAS /note="Acidic residues" REGION /note="Disordered" COMPBIAS /note="Acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered"	D->G:(6.0 %):US Gastric-carcinoma cell line
191	E	-	-	-	-		EDKAS	COMPBIAS /note="Acidic residues" REGION /note="Disordered" COMPBIAS /note="Acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered"
192	E	-	-	-	-		SAED	COMPBIAS /note="Acidic residues" REGION /note="Disordered" COMPBIAS /note="Acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered"
193	D	-	-	-	-		DSANKVG	COMPBIAS /note="Acidic residues" REGION /note="Disordered" COMPBIAS /note="Acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered"
194	E	-	-	-	-		ETSQK	COMPBIAS /note="Acidic residues" REGION /note="Disordered" COMPBIAS /note="Acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered"
195	E	-	-	-	-		ESQTK	COMPBIAS /note="Acidic residues" REGION /note="Disordered" COMPBIAS /note="Acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered"
196	D	-	-	-	-		DENGSK	COMPBIAS /note="Acidic residues" REGION /note="Disordered" COMPBIAS /note="Acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered"
197	E	-	-	-	-		ESL	COMPBIAS /note="Acidic residues" REGION /note="Disordered" COMPBIAS /note="Acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered"
198	E	-	-	-	-		EGALV	COMPBIAS /note="Acidic residues" REGION /note="Disordered" COMPBIAS /note="Acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered"
199	E	-	-	-	-		EFNI	COMPBIAS /note="Acidic residues" REGION /note="Disordered" COMPBIAS /note="Acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered"
200	E	-	-	-	-		KDEN	COMPBIAS /note="Acidic residues" REGION /note="Disordered" COMPBIAS /note="Acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered"
201	E	-	-	-	-		EDS	COMPBIAS /note="Acidic residues" REGION /note="Disordered" COMPBIAS /note="Acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered"
202	D	-	-	-	-		DKAE	COMPBIAS /note="Acidic residues" REGION /note="Disordered" COMPBIAS /note="Acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered"
203	E	-	-	-	-		EAD	COMPBIAS /note="Acidic residues" REGION /note="Disordered" COMPBIAS /note="Acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered"
204	E	-	-	-	-		EDY	COMPBIAS /note="Acidic residues" REGION /note="Disordered" COMPBIAS /note="Acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered"
205	D	-	-	-	-		DEI	COMPBIAS /note="Acidic residues" REGION /note="Disordered" COMPBIAS /note="Acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered"
206	E	-	-	-	-		ES	COMPBIAS /note="Acidic residues" REGION /note="Disordered" COMPBIAS /note="Acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered"
207	D	-	-	-	-		DEG	COMPBIAS /note="Acidic residues" REGION /note="Disordered" COMPBIAS /note="Acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered"
208	E	-	-	-	-		EDS	COMPBIAS /note="Acidic residues" REGION /note="Disordered" COMPBIAS /note="Acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered"
209	E	-	-	-	-		ED	COMPBIAS /note="Acidic residues" REGION /note="Disordered" COMPBIAS /note="Acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered"
210	E	-	-	-	-		ES	COMPBIAS /note="Acidic residues" REGION /note="Disordered" COMPBIAS /note="Acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered"
211	D	-	-	-	-		DT	COMPBIAS /note="Acidic residues" REGION /note="Disordered" COMPBIAS /note="Acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered"
212	D	-	-	-	-		DS	COMPBIAS /note="Acidic residues" REGION /note="Disordered" COMPBIAS /note="Acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered"
213	D	-	-	-	-		D	COMPBIAS /note="Acidic residues" REGION /note="Disordered" COMPBIAS /note="Acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered"
214	D	-	-	-	-		D	COMPBIAS /note="Acidic residues" REGION /note="Disordered" COMPBIAS /note="Acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered"
215	E	-	-	-	-		EQ	COMPBIAS /note="Acidic residues" REGION /note="Disordered" COMPBIAS /note="Acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered"