Contact Molecules for Homologous Proteins
[Summary Bars]	[Full Bars]	Site Table[0.0 %]	[Back to Search Page]	[Back to HOMCOS]
[Sites by Variants]	[SupCon3D]	[help]	seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]	[show] [download] [help]

PID	QueryLength	Homolgous Sequence in PDB	UniProt Query	TITLE
23668	346	189	YP_009725310.1()
QUERYSEQ	SLENVAFNVVNKGHFDGQQGEVPVSIINNTVYTKVDGVDVELFENKTTLPVNVAFELWAKRNIKPVPEVKILNNLGVDIAANTVIWDYKRDAPAHISTIGVCSMTDIAKKPTETICAPLTVFFDGRVDGQVDLFRNARNGVLITEGSVKG LQPSVGPKQASLNGVTLIGEAVKTQFNYYKKVDGVVQQLPETYFTQSRNLQEFKPRSQMEIDFLELAMDEFIERYKLEGYAFEHIVYGDFSHSQLGGLHLLIGLAKRFKESPFELEDFIPMDSTVKNYFITDAQTGSSKCVCSVIDLLLD DFVEIIKSQDLSVVSKVVKVTIDYTEISFMLWCKDGHVETFYPKLQ

  [n]:site number of query sequence.  [a]:amino acid of query sequence.  [s]:predicted secondary structure.
  [e]:predicted exposed/buried.  [acc]:predicted relative accesssibility(%).  [pdb]:PDB code of homologous structure.
  [contact_mols]:predicted binding molecules  [observed aa]:Observed amino acids among homologous sequences.  [feature table]:UniProt Feature Table
  [variant]:UniProt Human Variant.

n	a	s	e	acc	pdb	contact_mols	observed aa	feature table	variant
1	S		e	27.3	7n7r_B	homo	S	DISORDER predicted by DISOPRED
2	L	H	e	23.6	7n7r_B	homo	LI
3	E	H	e	37.2	7n7r_B	homo precipitant	ED
4	N	H	b	7.3	7n7r_B		N
5	V	H	b	0.7	7n7r_B		IV
6	A	H	b	0.0	7n7r_B		AVI
7	F	H	e	22.5	7n7r_B	homo	YF
8	N	H	b	0.0	7n7r_B		N
9	V	H	b	9.3	7n7r_B	homo	VLMF
10	V	H	e	44.0	7n7r_B	compound WNM homo	VLIY
11	N	H	e	54.5	7n7r_B	compound WNM homo	KN
12	K	H	e	50.5	7n7r_B	nucleotide homo	KQAGSTV
13	G	S	e	53.6	7n7r_B	homo	G
14	H	S	b	18.3	7n7r_B	nucleotide homo	HSAC
15	F		e	20.6	7n7r_B	compound WNM	FY
16	D		e	43.8	7n7r_B	nucleotide compound WNM	DTVI
17	G		e	64.3	7n7r_B	compound WNM	GA
18	Q		e	37.2	7n7r_B	nucleotide	VRQILAHD
19	Q		e	94.4	7n7r_B	nucleotide	AEDKQIT
20	G		b	15.5	7n7r_B		G
21	E		e	66.3	7n7r_B	homo	ED
22	V		b	15.3	7n7r_B	homo	LMAV
23	P		e	62.0	7n7r_B	homo precipitant	P
24	V	E	b	19.3	7n7r_B	homo precipitant	VCT
25	S	E	e	28.1	7n7r_B	homo	ASV
26	I	E	e	40.9	7n7r_B	homo	IV
27	I	E	e	48.0	7n7r_B	homo	VIMTLS
28	N	T	e	72.1	7n7r_B	homo	NGA
29	N	T	e	50.9	7n7r_B	homo	DNE
30	T	E	b	4.5	7n7r_B	homo	KRAT
31	V	E	b	0.0	7n7r_B		VIL
32	Y	E	e	20.9	7n7r_B	homo	FYVMIL
33	T	E	b	3.2	7n7r_B	homo	VTAI
34	K	E	e	54.2	7n7r_B	homo	KRI
35	V	E	e	46.0	7n7r_B	compound WNM homo	DISVENY
36	D	T	e	100.6	7n7r_B	compound O3G WNM ZQG homo precipitant	DGQN
37	G	T	e	70.2	7n7r_B	homo	GNTVPDK
38	V	E	e	62.0	7n7r_B	compound WUY homo precipitant	VTENADI
39	D	E	e	56.2	7n7r_B	compound WUY homo	DE
40	V	E	e	41.3	7n7r_B	compound WUY homo	VKNTI
41	E	E	e	51.3	7n7r_B	compound WUM homo precipitant	VLCEA
42	L	E	b	19.1	7n7r_B	compound WUG WUM WUV 0MI homo precipitant	IVLM
43	F	E	b	8.1	7n7r_B	compound WUG WUM WUV W3G B3P 0MI precipitant	F
44	E	E	e	50.3	7n7r_B	compound WUG WUM WUV W3G B3P 0MI homo precipitant	TEKVI
45	N		b	4.2	7n7r_B	homo	N
46	K		e	62.3	7n7r_B	compound WUM WUV homo precipitant	KNQE
47	T	S	b	11.0	7n7r_B	homo	T
48	T	S	e	97.4	7n7r_B	compound WUY homo precipitant	TSCAP
49	L	S	e	24.2	7n7r_B	compound WUY precipitant	LFY
50	P		e	54.3	7n7r_B	homo precipitant	P
51	V	H	b	13.3	7n7r_B	homo	TV
52	N	H	e	42.4	7n7r_B	homo precipitant	NS
53	V	H	b	2.7	7n7r_B	homo	VI
54	A	H	b	0.0	7n7r_B		A
55	F	H	b	0.0	7n7r_B	homo	FV
56	E	H	b	12.6	7n7r_B	homo precipitant	E
57	L	H	b	0.0	7n7r_B		L
58	W	H	b	19.5	7n7r_B	compound WUG WUM WUV W3G B3P 0MI homo precipitant	YFW
59	A	H	b	0.0	7n7r_B	homo	AT
60	K	T	b	13.7	7n7r_B	compound WNM homo	K
61	R	B	b	12.6	7n7r_B	compound WUV homo	R
62	N		b	10.3	7n7r_B		SKNA
63	I		e	39.2	7n7r_B	homo	IVLM
64	K	S	e	38.7	7n7r_B	nucleotide	RGKN
65	P		b	7.8	7n7r_B		LPHSTV
66	V	B	b	7.3	7n7r_B		HTVL
67	P		b	1.6	7n7r_B		P
68	E		b	4.0	7n7r_B	precipitant	EPDN
69	V	H	b	6.0	7n7r_B	precipitant	LVFIN
70	K	H	b	6.1	7n7r_B	compound RZG	KTSNR
71	I	H	b	1.2	7n7r_B		IL
72	L	H	b	0.0	7n7r_B	compound O3G homo	LF
73	N	H	e	40.0	7n7r_B	compound O3G ZQG homo precipitant	RKNH
74	N	H	e	26.1	7n7r_B	compound WNM homo precipitant	NG
75	L	T	b	3.4	7n7r_B	compound WNM precipitant	L
76	G	T	e	38.1	7n7r_B	compound O3G ZQG homo precipitant	GNEQ
77	V		b	5.3	7n7r_B	compound O3G ZQG homo precipitant	VIA
78	D		e	48.8	7n7r_B	compound O3G WL7 ZQG metal NA homo precipitant	DVT
79	I	E	b	1.2	7n7r_B	homo	VIAC
80	A	E	b	2.7	7n7r_B		TCA
81	A	S	b	0.9	7n7r_B	precipitant	YWANS
82	N	S	e	41.2	7n7r_B	compound WNM	KNGS
83	T	S	b	15.6	7n7r_B		FHTCL
84	V	B	b	4.0	7n7r_B		V
85	I		b	1.8	7n7r_B	compound O3G	LI
86	W	E	b	8.0	7n7r_B	compound WUG WUV W3G B3P 0MI precipitant	W
87	D	E	b	3.7	7n7r_B	compound WUY	D
88	Y	T	e	30.9	7n7r_B	compound WUG WUV 0MI homo precipitant	Y
89	K	T	e	47.2	7n7r_B	precipitant	EAKVD
90	R	T	e	40.7	7n7r_B	compound WUY homo precipitant	RAKNS
91	D	T	e	45.1	7n7r_B	compound WUV W3G B3P 0MI WUG WUM precipitant	EDSNQ
92	A	E	b	4.5	7n7r_B	compound WUY homo	RSANT
93	P	E	b	7.8	7n7r_B	compound WUY homo	PILV
94	A	S	b	12.5	7n7r_B	compound O3G homo precipitant	LFYA
95	H	S	b	10.5	7n7r_B	compound O3G WUY homo precipitant	CTGHYVS
96	I	S	e	86.0	7n7r_B	compound WUY WL7 homo precipitant	STRPNIV
97	S		e	28.9	7n7r_B	compound WL7 homo	SNFATY
98	T	E	b	4.5	7n7r_B		T
99	I	E	b	0.0	7n7r_B	precipitant	IKYV
100	G	S	e	38.1	7n7r_B	compound WNM precipitant	GKSDQ
101	V	S	b	13.3	7n7r_B	compound WNM	VI
102	C		b	2.7	7n7r_B	precipitant	C
103	S	T	e	75.0	7n7r_B	homo precipitant	KTSAGM
104	M	T	e	61.4	7n7r_B	homo precipitant	YM
105	T	T	b	10.4	7n7r_B		T
106	D	E	b	17.9	7n7r_B	homo	D
107	I	E	e	29.2	7n7r_B	compound WL7 homo	ILF
108	A	E	b	4.5	7n7r_B	homo	DAETKGLSFINPQRVY
109	K	S	e	50.5	7n7r_B		KVPSLAEGTDFINQRCHMWY
110	K	S	e	63.2	7n7r_B	nucleotide homo	NKLEQADGIPRSTVCFHMY
111	P	T	b	10.1	7n7r_B	homo	PSDCFLAGEIKRTVNQYHMW
112	T	T	e	55.2	7n7r_B	nucleotide homo precipitant	ANTIDLEGKSVFPQRCHMWY
113	E	S	e	39.7	7n7r_B	nucleotide homo precipitant	ELQAGSVDFIKNPRTCHMWY
114	T	G	e	79.9	7n7r_B	homo precipitant	NSDTLAEGVFIKPQRCHMWY
115	I	G	e	53.2	7n7r_B	compound WL7 homo	IVALFMGDEKSTNPQRYCHW
116	C	G	b	2.0	7n7r_B		CIAGLDEKSTVFNPQRYHMW
117	A	S	e	33.0	7n7r_B	homo	GASTDELVIKNPQRFYCHMW
118	P	S	e	71.3	7n7r_B	homo precipitant	GDKSNPCALEIRTVFQYHMW
119	L	S	e	28.1	7n7r_B	homo	LVAGSDEIKNPQRTCFHMWY
120	T		b	8.4	7n7r_B	metal NA precipitant	VNTCLADEGIKPSFHMQRY
121	V	E	b	1.3	7n7r_B		VTIAGLSDEFHKMNPQRY
122	F	E	b	0.5	7n7r_B		LCFAGSVDEHIKMNPQRTY
123	F	E	b	1.0	7n7r_B		FYV
124	D	E	b	1.9	7n7r_B		D
125	G	T	e	28.6	7n7r_B	compound VWG metal CL precipitant	GNID
126	R	T	e	20.6	7n7r_B	nucleotide compound VWG precipitant	RS
127	V	S	e	38.0	7n7r_B		DIVYQ
128	D	T	e	99.4	7n7r_B	nucleotide precipitant	NQALDEKTVPGIRS
129	G	T	e	48.8	7n7r_B	precipitant	GD
130	Q	H	b	5.6	7n7r_B	precipitant	SADQ
131	V	H	e	21.3	7n7r_B	compound GWG WJD VWG precipitant	LYFV
132	D	H	e	55.6	7n7r_B	nucleotide precipitant	EQDS
133	L	H	e	25.3	7n7r_B	nucleotide	RAKSL
134	F	H	b	1.9	7n7r_B	compound K3A GWG ZQM S6V	F
135	R	H	e	56.9	7n7r_B	nucleotide compound K3A GWG WJD EJW ZQM S6V 0OI	TRMKLCS
136	N	H	e	78.2	7n7r_B	nucleotide	SKLANTQRMV
137	A		b	14.3	7n7r_B	compound S6V	ATLSMC
138	R	S	e	51.0	7n7r_B	homo	RPKTDNQ
139	N	S	b	6.1	7n7r_B		ND
140	G	E	b	0.0	7n7r_B		AG
141	V	E	b	0.0	7n7r_B		VI
142	L	E	b	0.0	7n7r_B		LYF
143	I	E	b	0.0	7n7r_B		IFVM
144	T	E	b	5.8	7n7r_B	compound VWG metal CL precipitant	STN
145	E	S	e	48.7	7n7r_B	nucleotide compound VWG metal CL precipitant	TDELNPA
146	G	S	e	46.4	7n7r_B	nucleotide compound VWG precipitant	TRGQNSVE
147	S		e	86.7	7n7r_B	nucleotide compound VWG precipitant	KACSV
148	V	B	b	11.3	7n7r_B	compound K3A GWG WJD VWG EJW ZQM S6V 0OI metal CL precipitant	VIYLP
149	K	T	e	88.7	7n7r_B	compound K3A GWG WJD EJW ZQM S6V 0OI metal CL precipitant	KAS
150	G	T	e	89.3	7n7r_B	compound GWG 0OI metal CL precipitant	SGNKRCT
151	L	B	e	20.8	7n7r_B	compound K3A GWG WJD EJW ZQM S6V 0OI precipitant	LYVG
152	Q		e	84.2	7n7r_B	compound WUJ	STRPCGQ
153	P		e	42.6	7n7r_B	compound WUJ	PMCYKAGLSVDEFHINQRT
154	S	E	b	16.4	7n7r_B	compound WUJ precipitant	ISAVTMG
155	V	E	e	54.0	7n7r_B	compound WUJ precipitant	IKHVREL
156	G		b	1.2	7n7r_B		GKIS
157	P		b	4.7	7n7r_B	precipitant	PLYS
158	K	S	e	60.8	7n7r_B	compound ZQD precipitant	SQTNPKDA
159	Q		b	3.6	7n7r_B	precipitant	RYHNQAF
160	A	E	b	0.0	7n7r_B		AGLI
161	S	E	b	15.6	7n7r_B	precipitant	YLCSDEKM
162	L	E	e	21.9	7n7r_B	homo	LIFV
163	N	T	e	42.4	7n7r_B	homo	NG
164	G	T	e	33.3	7n7r_B	homo	GSADF
165	V	E	e	56.0	7n7r_B	compound JOV homo	VGMAT
166	T	E	e	26.6	7n7r_B	homo precipitant	PIHVYSTLM
167	L	E	e	29.2	7n7r_B	homo	VLIMT
168	I		e	39.2	7n7r_B	compound ZQD homo precipitant	VYIRKNEFS
169	G		e	25.0	7n7r_B	compound ZQD WNM homo precipitant	GDVTAS
170	E	S	e	98.5	7n7r_B	compound ZQD WNM homo precipitant	EPNDGHAKS
171	A	S	e	92.9	7n7r_B	compound WNM ZQD homo precipitant	ASKDEGTL
172	V	S	e	42.7	7n7r_B	compound ZQD WNM homo precipitant	VTPDRGIQLAS
173	K		e	59.9	7n7r_B	nucleotide compound ZQD WNM homo precipitant	GKPEVANRLS
174	T		b	3.9	7n7r_B	compound ZQD homo	TEKGFPISVAL
175	Q		e	45.4	7n7r_B	compound ZQD homo precipitant	QWNVSEAFLT
176	F		b	1.4	7n7r_B	homo precipitant	FYVPLTI
177	N	E	b	15.2	7n7r_B	precipitant	WYSNLAI
178	Y	E	b	1.3	7n7r_B		YLWMVIQF
179	Y	E	b	2.2	7n7r_B		YTAFRV
180	K	E	b	16.5	7n7r_B	compound WNM precipitant	KLERMTDIV
181	K	E	b	7.1	7n7r_B	compound K3A GWG WJD EJW ZQM S6V 0OI	RKQFWDSY
182	V	E	e	31.3	7n7r_B	compound WUJ WNM	VKLGN
183	D	T	e	56.8	7n7r_B	compound WUJ	DNGR
184	G	T	e	50.0	7n7r_B	compound K3A WJD EJW ZQM S6V 0OI	GNDEV
185	V	E	e	60.7	7n7r_B	compound WUJ	EAKSVYQI
186	V	E	e	42.7	7n7r_B	compound K3A GWG WJD EJW ZQM S6V 0OI	FAILVPS
187	Q		e	38.3	7n7r_B	compound WUJ WNM precipitant	VRQEFINY
188	Q		e	100.0	7n7r_B	compound WUJ WNM	QEDVASTR
189	L		b	19.7	7n7r_B	compound WUJ WNM precipitant	LPSFHIRY
190	P		e	47.3	7n7r_B	compound WUJ WNM precipitant	PTYASL
191	E		e	92.0	7n7r_B	compound WUJ ZQJ precipitant	DENQ
192	T		e	21.4	7n7r_B	compound ZQJ precipitant	TGSC
193	Y	B	e	22.6	7n7r_B	compound ZQJ precipitant	YLIFV
194	F		b	15.8	7n7r_B	precipitant	FYN
195	T		b	0.6	7n7r_B	compound RZG	TS
196	Q		b	14.3	7n7r_B	compound RZG precipitant	QTSCL
197	S		b	18.8	7n7r_B	compound RZG precipitant	GS
198	R		b	9.9	7n7r_B	compound RZG precipitant	R
199	N		e	50.9	7n7r_B	precipitant	TNSVDFAGLEIKPQRY
200	L	S	b	17.4	7n7r_B	compound JOV precipitant	LVYFICTAGDEKNPQRS
201	Q	T	e	75.0	7n7r_B	compound JOV homo	SEQDANLGIKPRTVCFHMY
202	E	T	e	67.8	7n7r_B	compound JOV homo	DTESAGLFIKNPQRVY
203	F		b	12.4	7n7r_B	compound ZQA	FHADEGIKLPRSTV
204	K		e	67.5	7n7r_B	homo precipitant	ETKDQLASGIPRV
205	P		e	32.6	7n7r_B	compound ZQA	PTACDEGIKLRSV
206	R		e	36.8	7n7r_B	precipitant	RSNLVADEGIKPT
207	S	S	b	19.5	7n7r_B	precipitant	STKADEGILPRV
208	Q	H	e	62.2	7n7r_B	precipitant	DNQRTEPAGIKLSV
209	M	H	b	8.7	7n7r_B	precipitant	MIFLAV
210	E	H	b	0.0	7n7r_B		ENADGIKLPRSTV
211	I	H	e	37.4	7n7r_B	compound ZQA	VEKRITYADGLPS
212	D	H	b	8.0	7n7r_B		DQAEGIKLPRSTV
213	F	H	b	0.0	7n7r_B		FCADEGIKLNPQRSTV
214	L	H	b	7.9	7n7r_B	compound ZQA homo	LIRMADEGKNPQSTV
215	E	H	e	59.3	7n7r_B	compound ZQA homo	DESAQNV
216	L	S	b	12.9	7n7r_B		LMYEF
217	A		e	45.5	7n7r_B		DALSE
218	M	H	e	33.3	7n7r_B		EDMISQT
219	D	H	e	74.1	7n7r_B		DEGSTN
220	E	H	e	53.3	7n7r_B		VLTRKECDS
221	F	H	b	0.0	7n7r_B		FIADEGKLPRSTV
222	I	H	b	4.1	7n7r_B		IPAVLDEGKRST
223	E	H	e	64.3	7n7r_B		EKAQNDS
224	R	H	e	55.3	7n7r_B		KRNADEGILPSTV
225	Y	T	e	20.9	7n7r_B	precipitant	YHEADGIKLPRSTV
226	K	T	e	72.6	7n7r_B		GVKSDALEFINPQRTY
227	L		b	0.0	7n7r_B		LADEGIKPRSTVCFHMNQY
228	E	T	e	51.8	7n7r_B	precipitant	EKHQAGLSDFINPRTVY
229	G	T	e	42.9	7n7r_B	precipitant	DGANLEIKPRSTVCFHMQY
230	Y	S	e	22.2	7n7r_B	precipitant	YLFADEGIKPRSTVCHMNQ
231	A		b	9.8	7n7r_B		AGSNDEIKLPQRTV
232	F	H	b	0.0	7n7r_B		FLHADEGIKNPQRSTV
233	E	H	e	38.7	7n7r_B		EPQDAGIKLNRSTV
234	H	H	e	30.4	7n7r_B	nucleotide compound U3P UVC VQV precipitant	H
235	I	H	b	0.0	7n7r_B		VIA
236	V	T	b	0.0	7n7r_B		VFCL
237	Y	T	b	10.0	7n7r_B		YAIFL
238	G		b	16.7	7n7r_B		G
239	D	B	e	30.2	7n7r_B		DESQN
240	F		b	15.3	7n7r_B	homo precipitant	FVI
241	S	S	e	68.0	7n7r_B	compound WNM homo	SNDTK
242	H	S	e	60.2	7n7r_B	nucleotide compound WNM homo precipitant	KHGDQRY
243	S	S	e	82.0	7n7r_B	nucleotide homo precipitant	TKSPG
244	Q	B	e	67.3	7n7r_B	nucleotide compound CMU U5P UVC VQV homo precipitant	TQDIV
245	L		b	0.6	7n7r_B	nucleotide compound UVC homo precipitant	LIV
246	G	B	b	9.5	7n7r_B	nucleotide compound U3P UVC VQV precipitant	G
247	G		b	1.2	7n7r_B	nucleotide compound U3P UVC VQV precipitant	G
248	L		b	0.0	7n7r_B		LVCSM
249	H		b	7.3	7n7r_B	nucleotide compound U5P CMU U3P UVC VQV precipitant	H
250	L	B	b	0.6	7n7r_B		LHFTADEGIKPRSV
251	L	H	b	9.0	7n7r_B	compound RZG precipitant	LVIMADEGKPRST
252	I	H	b	0.0	7n7r_B		IVAGLDEFKNPQRSTY
253	G	H	b	2.4	7n7r_B		GSAHDEIKLPRTV
254	L	H	b	0.0	7n7r_B	compound RZG	LQVMADEGIKPRST
255	A	H	b	4.5	7n7r_B	compound ZQA homo	YVATFIGLSDEKNPQR
256	K	H	b	14.2	7n7r_B		RKNSADEGILPTV
257	R	H	b	14.6	7n7r_B	metal MG precipitant	LRKGADEIPSTV
258	F	H	e	26.8	7n7r_B	compound JOV	YLSFQAKHM
259	K	H	e	64.6	7n7r_B	compound ZQA	KRQSCADEGILPTV
260	E	H	e	64.8	7n7r_B	precipitant	MGEKQATDILPRSV
261	S	S	b	10.2	7n7r_B	metal MG	SGNALDEFIKPQRTVY
262	P		e	58.1	7n7r_B	compound JOV metal MG homo	HNKVLPIADEGRSTCFMQY
263	F	E	b	7.2	7n7r_B	compound JOV	LIFADEGKPRSTVCHMNQY
264	E	E	e	69.8	7n7r_B	compound JOV 0MI homo	KVNYILSEAGDFHMPQRT
265	L	E	e	24.7	7n7r_B	compound JOV RZG homo	LAIMVDEGKNPQRST
266	E	E	e	52.3	7n7r_B	compound WUV 0MI B3P homo precipitant	EPQKDAGILNRSTV
267	D		e	39.5	7n7r_B	homo	EDPRSTAGIKLNQV
268	F	S	e	37.8	7n7r_B	homo	FVIML
269	I	S	e	50.9	7n7r_B	compound WNM homo	LVITM
270	P		e	61.2	7n7r_B	compound WUY homo	PNKSQGAT
271	M	S	e	32.4	7n7r_B	compound WUY homo	SAYKMTDGEILNPQRV
272	D		b	6.2	7n7r_B	precipitant	DERSAGIKLNPQTV
273	S		e	27.3	7n7r_B	compound RZG precipitant	SANIT
274	T	S	b	5.8	7n7r_B	compound RZG precipitant	TVSYD
275	V	S	e	20.7	7n7r_B	precipitant	VALI
276	K	E	b	12.3	7n7r_B	compound RZG	KHVQTRADEGILPS
277	N	E	e	26.7	7n7r_B	compound WNM homo precipitant	SNPVCADEGIKLRT
278	Y	E	b	17.0	7n7r_B	compound RZG precipitant	YCGIADEKLPRSTV
279	F	E	e	32.1	7n7r_B	homo	FATVLC
280	I	E	b	0.0	7n7r_B	homo	VITS
281	T	E	e	39.0	7n7r_B	homo	TGSLI
282	D	E	b	0.0	7n7r_B	metal MG homo	DYLAPEGKSTV
283	A	T	e	62.5	7n7r_B	compound JOV metal MG homo	SAIQGELTV
284	Q	T	e	70.4	7n7r_B	metal MG homo precipitant	NDKLEQP
285	T	T	e	44.8	7n7r_B	homo precipitant	TNVADSCEGIKLPR
286	G		e	59.5	7n7r_B	homo	GAPLDEIKRSTV
287	S		b	2.3	7n7r_B	homo	SARG
288	S	E	e	31.2	7n7r_B	homo precipitant	SAYF
289	K	E	b	9.0	7n7r_B	nucleotide compound U5P CMU U3P UVC VQV homo precipitant	KV
290	C	E	e	53.3	7n7r_B	homo precipitant	AQSKCNMTV
291	V	E	e	33.3	7n7r_B	nucleotide compound U5P CMU UVC homo precipitant	VRA
292	C	E	b	0.7	7n7r_B	nucleotide compound U5P CMU UVC precipitant	CT
293	S	E	b	0.0	7n7r_B	nucleotide compound U5P CMU UVC precipitant	TS
294	V	E	b	4.0	7n7r_B	compound RZG	VLY
295	I	B	b	1.8	7n7r_B	compound RZG	VIMT
296	D		b	8.6	7n7r_B	compound RZG	D
297	L		b	0.0	7n7r_B		LVI
298	L		b	15.7	7n7r_B		LYCKIR
299	L	H	b	0.0	7n7r_B		LA
300	D	H	e	29.0	7n7r_B		DPN
301	D	H	e	24.1	7n7r_B		DQS
302	F	H	b	2.4	7n7r_B		FL
303	V	H	b	6.0	7n7r_B	precipitant	VEYLI
304	E	H	e	53.8	7n7r_B	compound ZQJ precipitant	EANTPSDMV
305	I	H	b	2.3	7n7r_B		IYLKV
306	I	H	b	0.0	7n7r_B		LIV
307	K	H	e	39.6	7n7r_B	precipitant	KHL
308	S	T	e	63.3	7n7r_B		SPQAEN
309	Q	S	e	24.5	7n7r_B		LQEMYV
310	D		e	55.6	7n7r_B		DNITGYAEKLPRSV
311	L		b	15.7	7n7r_B	precipitant	LAGRTDEIKPSV
312	S		e	68.8	7n7r_B	homo precipitant	SNGTDALEFIKPQRVY
313	V	S	e	54.0	7n7r_B	homo precipitant	VCTNADEFGIKLPQRS
314	V	S	e	63.3	7n7r_B	nucleotide homo precipitant	VQKIADEGLPRST
315	S	E	e	35.9	7n7r_B	nucleotide homo	S
316	K	E	e	38.2	7n7r_B	nucleotide homo	KR
317	V	E	e	39.3	7n7r_B	nucleotide homo	VC
318	V	E	b	4.0	7n7r_B		VHIWY
319	K	E	e	60.8	7n7r_B	metal CL precipitant	KNEFTDQ
320	V	E	b	7.3	7n7r_B	precipitant	VIC
321	T	E	e	30.5	7n7r_B	metal CL precipitant	NMIPSTCV
322	I	E	b	0.0	7n7r_B		IVL
323	D	T	b	0.6	7n7r_B		D
324	Y	T	b	7.0	7n7r_B	compound WNM precipitant	FYCLN
325	T	E	e	26.0	7n7r_B	homo	KTQHA
326	E	E	e	55.8	7n7r_B	homo precipitant	EPDMSVA
327	I	E	b	12.9	7n7r_B	homo precipitant	IVFWCY
328	S	E	b	7.8	7n7r_B	homo	RQENSK
329	F	E	b	0.0	7n7r_B	homo	FLW
330	M	E	b	10.6	7n7r_B	nucleotide homo	M
331	L	E	b	1.1	7n7r_B		LVT
332	W	E	e	34.3	7n7r_B	nucleotide compound WOY U3P VQV WUS ZQJ homo precipitant	WF
333	C	E	b	2.0	7n7r_B	precipitant	CAF
334	K	E	e	50.5	7n7r_B	nucleotide precipitant	KEN
335	D	T	e	84.6	7n7r_B	precipitant	DENG
336	G	T	e	56.0	7n7r_B	precipitant	GDNEHS
337	H	E	e	37.2	7n7r_B	precipitant	KHDSQA
338	V	E	b	3.3	7n7r_B		IVL
339	E	E	e	43.7	7n7r_B	nucleotide compound WOY U3P VQV WUS ZQJ precipitant	QKMSEA
340	T	E	b	12.3	7n7r_B	nucleotide compound WOY U3P UVC VQV ZQJ precipitant	T
341	F	E	b	0.5	7n7r_B		FC
342	Y	E	e	21.3	7n7r_B	nucleotide compound U5P WOY CMU U3P UVC VQV WUS ZQJ precipitant	Y
343	P	E	b	2.3	7n7r_B	nucleotide compound U5P UVC precipitant	P
344	K		e	35.4	7n7r_B	nucleotide compound U5P CMU UVC precipitant	QRK
345	L		e	49.4	7n7r_B	nucleotide compound U5P WNM homo precipitant	LM
346	Q		e	94.4	7n7r_B	compound WNM homo	Q