[All Sites]

Contact Molecules for Homologous Proteins

[Summary Bars]
[Full Bars]


Sites by Variants[0.0 %]


[Back to Search Page]
[Back to HOMCOS]

[SupCon3D]
[help] 		seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
18568 212 24 P05231(IL6_HUMAN) RecName: Full=Interleukin-6 ; Short=IL-6;AltName: Full=B-cell stimulatory factor 2; Short=BSF-2;AltName: Full=CTL differentiation factor; Short=CDF;AltName: Full=Hybridoma growth factor;AltName: Full=Interferon beta-2; Short=IFN-beta-2;Flags: Precursor;
QUERYSEQ 
MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVL
IQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

Statistics of sites in view of Disease classification

All LB/B (likely benign or benign)
Number of sites 212 2
Buired or ExposedBuried 38.6 (%) [71] 0.0 (%) [0]
Exposed 61.4 (%) [113] 100.0 (%) [2]
Ave relacc 35.7 % 67.4 %
SD relacc 29.66 % 25.15 %
Contact Molhetero 38.2 (%) [81] 0.0 (%) [0]
nucleotide 13.2 (%) [28] 0.0 (%) [0]
compound 0.0 (%) [0] 0.0 (%) [0]
metal 0.0 (%) [0] 0.0 (%) [0]
otherpoly 0.0 (%) [0] 0.0 (%) [0]
homo 16.5 (%) [35] 50.0 (%) [1]
precipitant 8.5 (%) [18] 0.0 (%) [0]
Number of variants 3 3
N_Freq(AAvariant)==0 % 33.3 % [1]
N_Freq(AAvariant)>0 % 66.7 % [2]
Ave Freq(AAvariant) 6.0 %
SD Freq(AAvariant) 5.35 %

Site Table for OMIM:LB/B [3 variants]

2 sites 32,162
  [n]:site number of query sequence.  [a]:amino acid of query sequence.  [s]:predicted secondary structure.
  [e]:predicted exposed/buried.  [acc]:predicted relative accesssibility(%).  [pdb]:PDB code of homologous structure.
  [contact_mols]:predicted binding molecules  [observed aa]:Observed amino acids among homologous sequences.  [feature table]:UniProt Feature Table
  [variant]:UniProt Human Variant.
n a s e acc pdb contact_mols observed aa feature table variant
32P e 42.3 2l3y_A 
LRVPQ
 DISORDER predicted by DISOPRED P->S:(0.0 %):LB/B - dbSNP:rs2069830
162D e 92.6 4cni_C homo 
DGENTVHYS
 D->V:(5.0 %):LB/B - dbSNP:rs2069860;D->E:(13.0 %):LB/B - dbSNP:rs1330643