Contact Molecules for Homologous Proteins | ||||
[Summary Bars] |
[Full Bars] |
|
[Back to Search Page] |
[Back to HOMCOS] |
[SupCon3D] |
[help] |
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100] | [show] [download] [help] |
PID | QueryLength | Homolgous Sequence in PDB | UniProt Query | TITLE |
5461 | 121 | 9 | P0DTC8(NS8_SARS2) | RecName: Full=ORF8 protein; Short=ORF8;AltName: Full=Non-structural protein 8; Short=ns8;Flags: Precursor; |
QUERYSEQ |
MKFLVFLGIITTVAAFHQECSLQSCTQHQPYVVDDPCPIHFYSKWYIRVGARKSAPLIELCVDEAGSKSPIQYIDIGNYTVSCLPFTINCQEPKLGSLVVRCSFYEDFLEYHDVRVVLDFI |
All | ||
Number of sites | 121 | |
Buired or Exposed | Buried | 36.8 (%) [39] |
Exposed | 63.2 (%) [67] | |
Ave relacc | 38.1 % | |
SD relacc | 28.82 % | |
Contact Mol | hetero | 21.5 (%) [26] |
nucleotide | 0.0 (%) [0] | |
compound | 6.6 (%) [8] | |
metal | 14.9 (%) [18] | |
otherpoly | 0.0 (%) [0] | |
homo | 29.8 (%) [36] | |
precipitant | 8.3 (%) [10] | |
Number of variants | 0 | |
N_Freq(AAvariant)==0 % | ||
N_Freq(AAvariant)>0 % | ||
Ave Freq(AAvariant) | ||
SD Freq(AAvariant) |