#WARNING:no index is registered index "YP_009724395.1" in "https://rest.uniprot.org/uniprotkb/" url "https://rest.uniprot.org/uniprotkb/YP_009724395.1.txt".
Please visit the UniProt website(https://www.uniprot.org), and get a proper ID/AC for your query protein.

[All Sites]

Contact Molecules for Homologous Proteins

[Summary Bars]
[Full Bars]


Sites by Variants[0.0 %]


[Back to Search Page]
[Back to HOMCOS]

[SupCon3D]
[help] 		seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
22162 121 4 YP_009724395.1()
QUERYSEQ 
MKIILFLALITLATCELYHYQECVRGTTVLLKEPCSSGTYEGNSPFHPLADNKFALTCFSTQFAFACPDGVKHVYQLRARSVSPKLFIRQEEVQELYSPIFLIVAAIVFITLCFTLKRKTE
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

Statistics of sites in view of Disease classification

All
Number of sites 121
Buired or ExposedBuried 31.8 (%) [27]
Exposed 68.2 (%) [58]
Ave relacc 41.0 %
SD relacc 27.39 %
Contact Molhetero 0.0 (%) [0]
nucleotide 0.0 (%) [0]
compound 0.0 (%) [0]
metal 0.0 (%) [0]
otherpoly 0.0 (%) [0]
homo 0.0 (%) [0]
precipitant 0.0 (%) [0]
Number of variants 0
N_Freq(AAvariant)==0 %
N_Freq(AAvariant)>0 %
Ave Freq(AAvariant)
SD Freq(AAvariant)