[All Sites]

Contact Molecules for Homologous Proteins

[Summary Bars]
[Full Bars]


Sites by Variants[0.0 %]


[Back to Search Page]
[Back to HOMCOS]

[SupCon3D]
[help] 		seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
2715 75 30 P0DTC4(VEMP_SARS2) RecName: Full=Envelope small membrane protein ; Short=E; Short=sM protein ;
QUERYSEQ 
MYSFVSEETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCCNIVNVSLVKPSFYVYSRVKNLNSSRVPDLLV
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

Statistics of sites in view of Disease classification

All
Number of sites 75
Buired or ExposedBuried 3.0 (%) [2]
Exposed 97.0 (%) [65]
Ave relacc 67.2 %
SD relacc 25.80 %
Contact Molhetero 13.3 (%) [10]
nucleotide 0.0 (%) [0]
compound 0.0 (%) [0]
metal 0.0 (%) [0]
otherpoly 0.0 (%) [0]
homo 46.7 (%) [35]
precipitant 1.3 (%) [1]
Number of variants 0
N_Freq(AAvariant)==0 %
N_Freq(AAvariant)>0 %
Ave Freq(AAvariant)
SD Freq(AAvariant)