#WARNING:no index is registered index "YP_009724397.2" in "https://rest.uniprot.org/uniprotkb/" url "https://rest.uniprot.org/uniprotkb/YP_009724397.2.txt".
Please visit the UniProt website(https://www.uniprot.org), and get a proper ID/AC for your query protein.

[All Sites]

Contact Molecules for Homologous Proteins


[Summary Bars]

[Full Bars]


Sites by Variants[0 %]


[Back to Search Page]

[Back to HOMCOS]

[SupCon3D]

[help]
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
24252 419 260 YP_009724397.2()
QUERYSEQ
MSDNGPQNQRNAPRITFGGPSDSTGSNQNGERSGARSKQRRPQGLPNNTASWFTALTQHGKEDLKFPRGQGVPINTNSSPDDQIGYYRRATRRIRGGDGKMKDLSPRWYFYYLGTGPEAGLPYGANKDGIIWVATEGALNTPKDHIGTRN
PANNAAIVLQLPQGTTLPKGFYAEGSRGGSQASSRSSSRSRNSSRNSTPGSSRGTSPARMAGNGGDAALALLLLDRLNQLESKMSGKGQQQQGQTVTKKSAAEASKKPRQKRTATKAYNVTQAFGRRGPEQTQGNFGDQELIRQGTDYKH
WPQIAQFAPSASAFFGMSRIGMEVTPSGTWLTYTGAIKLDDKDPNFKDQVILLNKHIDAYKTFPPTEPKKDKKKKADETQALPQRQKKQQTVTLLPAADLDDFSKQLQQSMSSADSTQA
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

Statistics of sites in view of Disease classification

All
Number of sites 419
Buired or ExposedBuried 39.9 (%) [167]
Exposed 60.1 (%) [252]
Ave relacc 34.0 %
SD relacc 27.54 %
Contact Molhetero 27.7 (%) [116]
nucleotide 9.1 (%) [38]
compound 13.1 (%) [55]
metal 15.0 (%) [63]
otherpoly 0.0 (%) [0]
homo 51.1 (%) [214]
precipitant 32.7 (%) [137]
Number of variants 0
N_Freq(AAvariant)==0 %
N_Freq(AAvariant)>0 %
Ave Freq(AAvariant)
SD Freq(AAvariant)