[All Sites]

Contact Molecules for Homologous Proteins


[Summary Bars]

[Full Bars]


Sites by Variants[40 %]


[Back to Search Page]

[Back to HOMCOS]

[SupCon3D]

[help]
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
3506 39 0 Q7TFA0(NS8A_SARS) RecName: Full=ORF8a protein;AltName: Full=Accessory protein 8a;AltName: Full=Protein non-structural 8a; Short=ns8a;Flags: Precursor;
QUERYSEQ
MKLLIVLTCISLCSCICTVVQRCASNKPHVLEDPCKVQH
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

Statistics of sites in view of Disease classification

All
Number of sites 39
Ave relacc 0.0 %
SD relacc 0.00 %
Contact Molhetero 0.0 (%) [0]
nucleotide 0.0 (%) [0]
compound 0.0 (%) [0]
metal 0.0 (%) [0]
otherpoly 0.0 (%) [0]
homo 0.0 (%) [0]
precipitant 0.0 (%) [0]
Number of variants 0
N_Freq(AAvariant)==0 %
N_Freq(AAvariant)>0 %
Ave Freq(AAvariant)
SD Freq(AAvariant)