PSIBLAST 2.11.0+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Stephen F. Altschul, John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Reference for composition-based statistics starting in round 2: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: uniprot_sprot.fasta 571,282 sequences; 206,678,396 total letters Results from round 1 Query= sp|Q7TFA0|NS8A_SARS ORF8a protein OS=Severe acute respiratory syndrome coronavirus OX=694009 GN=8a PE=3 SV=1 Length=39 Score E Sequences producing significant alignments: (Bits) Value sp|Q7TFA0|NS8A_SARS ORF8a protein OS=Severe acute respiratory syn... 78.2 6e-21 sp|Q0Q469|NS8_BC279 Non-structural protein 8 OS=Bat coronavirus 2... 33.1 0.016 sp|Q3I5I8|NS8_BCRP3 Non-structural protein 8 OS=Bat coronavirus R... 33.1 0.017 sp|Q3LZX5|NS8_BCHK3 Non-structural protein 8 OS=Bat coronavirus H... 29.3 0.46 sp|P0DTC8|NS8_SARS2 ORF8 protein OS=Severe acute respiratory synd... 27.7 1.7 sp|Q5F226|FAT2_MOUSE Protocadherin Fat 2 OS=Mus musculus OX=10090... 26.9 3.6 sp|Q3I5J0|NS7A_BCRP3 Protein 7a OS=Bat coronavirus Rp3/2004 OX=34... 26.6 4.8 sp|Q3LZX7|NS7A_BCHK3 Protein 7a OS=Bat coronavirus HKU3 OX=442736... 25.8 8.7 >sp|Q7TFA0|NS8A_SARS ORF8a protein OS=Severe acute respiratory syndrome coronavirus OX=694009 GN=8a PE=3 SV=1 Length=39 Score = 78.2 bits (191), Expect = 6e-21, Method: Compositional matrix adjust. Identities = 39/39 (100%), Positives = 39/39 (100%), Gaps = 0/39 (0%) Query 1 MKLLIVLTCISLCSCICTVVQRCASNKPHVLEDPCKVQH 39 MKLLIVLTCISLCSCICTVVQRCASNKPHVLEDPCKVQH Sbjct 1 MKLLIVLTCISLCSCICTVVQRCASNKPHVLEDPCKVQH 39 >sp|Q0Q469|NS8_BC279 Non-structural protein 8 OS=Bat coronavirus 279/2005 OX=389167 GN=8 PE=3 SV=1 Length=121 Score = 33.1 bits (74), Expect = 0.016, Method: Compositional matrix adjust. Identities = 17/42 (40%), Positives = 26/42 (62%), Gaps = 4/42 (10%) Query 1 MKLLIVLTCISLCSCI---CTVVQRCASNKPHVLEDPCKVQH 39 MKLLIV ++ CI C++ Q C N+P+ +EDPC + + Sbjct 1 MKLLIVFGLLTSVYCIHKECSI-QECCENQPYQIEDPCPIHY 41 >sp|Q3I5I8|NS8_BCRP3 Non-structural protein 8 OS=Bat coronavirus Rp3/2004 OX=349344 GN=8 PE=3 SV=1 Length=121 Score = 33.1 bits (74), Expect = 0.017, Method: Compositional matrix adjust. Identities = 17/42 (40%), Positives = 26/42 (62%), Gaps = 4/42 (10%) Query 1 MKLLIVLTCISLCSCI---CTVVQRCASNKPHVLEDPCKVQH 39 MKLLIV ++ CI C++ Q C N+P+ +EDPC + + Sbjct 1 MKLLIVFGLLTSVYCIHKECSI-QECCENQPYQIEDPCPIHY 41 >sp|Q3LZX5|NS8_BCHK3 Non-structural protein 8 OS=Bat coronavirus HKU3 OX=442736 GN=8 PE=3 SV=1 Length=121 Score = 29.3 bits (64), Expect = 0.46, Method: Composition-based stats. Identities = 16/42 (38%), Positives = 25/42 (60%), Gaps = 4/42 (10%) Query 1 MKLLIVLTCISLCSCI---CTVVQRCASNKPHVLEDPCKVQH 39 MKLLIV ++ C C++ Q C N+P+ +EDPC + + Sbjct 1 MKLLIVFGLLASVYCFHRECSI-QECCENQPYQIEDPCPIHY 41 >sp|P0DTC8|NS8_SARS2 ORF8 protein OS=Severe acute respiratory syndrome coronavirus 2 OX=2697049 GN=8 PE=1 SV=1 Length=121 Score = 27.7 bits (60), Expect = 1.7, Method: Compositional matrix adjust. Identities = 13/41 (32%), Positives = 24/41 (59%), Gaps = 4/41 (10%) Query 1 MKLLIVLTCISLCSCI---CTVVQRCASNKPHVLEDPCKVQ 38 MK L+ L I+ + C++ Q C ++P+V++DPC + Sbjct 1 MKFLVFLGIITTVAAFHQECSL-QSCTQHQPYVVDDPCPIH 40 >sp|Q5F226|FAT2_MOUSE Protocadherin Fat 2 OS=Mus musculus OX=10090 GN=Fat2 PE=1 SV=1 Length=4351 Score = 26.9 bits (58), Expect = 3.6, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 19/34 (56%), Gaps = 5/34 (15%) Query 1 MKLLIVLTCISLCSCICTVVQRCASNKPHVLEDP 34 + LLI+ T L C +RC S+KP +EDP Sbjct 4058 LPLLIIATVGLLLYC-----RRCKSHKPVAMEDP 4086 >sp|Q3I5J0|NS7A_BCRP3 Protein 7a OS=Bat coronavirus Rp3/2004 OX=349344 GN=7a PE=3 SV=1 Length=122 Score = 26.6 bits (57), Expect = 4.8, Method: Composition-based stats. Identities = 13/35 (37%), Positives = 20/35 (57%), Gaps = 0/35 (0%) Query 1 MKLLIVLTCISLCSCICTVVQRCASNKPHVLEDPC 35 MK+++ LT I+L SC Q C +L++PC Sbjct 1 MKIILFLTLIALASCELYHYQECVRGTTVLLKEPC 35 >sp|Q3LZX7|NS7A_BCHK3 Protein 7a OS=Bat coronavirus HKU3 OX=442736 GN=7a PE=3 SV=1 Length=122 Score = 25.8 bits (55), Expect = 8.7, Method: Composition-based stats. Identities = 12/35 (34%), Positives = 20/35 (57%), Gaps = 0/35 (0%) Query 1 MKLLIVLTCISLCSCICTVVQRCASNKPHVLEDPC 35 MK+++ LT I+L +C Q C +L++PC Sbjct 1 MKIILFLTLIALATCELYHYQECVRGTTVLLKEPC 35 Lambda K H a alpha 0.332 0.138 0.475 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0410 0.140 1.90 42.6 43.6 Effective search space used: 5180544980 Results from round 2 Query= sp|Q7TFA0|NS8A_SARS ORF8a protein OS=Severe acute respiratory syndrome coronavirus OX=694009 GN=8a PE=3 SV=1 Length=39 Score E Sequences producing significant alignments: (Bits) Value Sequences used in model and found again: sp|Q7TFA0|NS8A_SARS ORF8a protein OS=Severe acute respiratory syn... 48.9 2e-09 Sequences not found previously or not previously below threshold: sp|Q0Q469|NS8_BC279 Non-structural protein 8 OS=Bat coronavirus 2... 30.0 0.23 sp|Q3I5I8|NS8_BCRP3 Non-structural protein 8 OS=Bat coronavirus R... 30.0 0.24 sp|Q3LZX5|NS8_BCHK3 Non-structural protein 8 OS=Bat coronavirus H... 29.2 0.52 sp|Q3I5J0|NS7A_BCRP3 Protein 7a OS=Bat coronavirus Rp3/2004 OX=34... 26.5 5.1 sp|Q3LZX7|NS7A_BCHK3 Protein 7a OS=Bat coronavirus HKU3 OX=442736... 25.7 9.4 >sp|Q7TFA0|NS8A_SARS ORF8a protein OS=Severe acute respiratory syndrome coronavirus OX=694009 GN=8a PE=3 SV=1 Length=39 Score = 48.9 bits (115), Expect = 2e-09, Method: Composition-based stats. Identities = 39/39 (100%), Positives = 39/39 (100%), Gaps = 0/39 (0%) Query 1 MKLLIVLTCISLCSCICTVVQRCASNKPHVLEDPCKVQH 39 MKLLIVLTCISLCSCICTVVQRCASNKPHVLEDPCKVQH Sbjct 1 MKLLIVLTCISLCSCICTVVQRCASNKPHVLEDPCKVQH 39 >sp|Q0Q469|NS8_BC279 Non-structural protein 8 OS=Bat coronavirus 279/2005 OX=389167 GN=8 PE=3 SV=1 Length=121 Score = 30.0 bits (66), Expect = 0.23, Method: Composition-based stats. Identities = 17/42 (40%), Positives = 26/42 (62%), Gaps = 4/42 (10%) Query 1 MKLLIVLTCISLCSCI---CTVVQRCASNKPHVLEDPCKVQH 39 MKLLIV ++ CI C++ Q C N+P+ +EDPC + + Sbjct 1 MKLLIVFGLLTSVYCIHKECSI-QECCENQPYQIEDPCPIHY 41 >sp|Q3I5I8|NS8_BCRP3 Non-structural protein 8 OS=Bat coronavirus Rp3/2004 OX=349344 GN=8 PE=3 SV=1 Length=121 Score = 30.0 bits (66), Expect = 0.24, Method: Composition-based stats. Identities = 17/42 (40%), Positives = 26/42 (62%), Gaps = 4/42 (10%) Query 1 MKLLIVLTCISLCSCI---CTVVQRCASNKPHVLEDPCKVQH 39 MKLLIV ++ CI C++ Q C N+P+ +EDPC + + Sbjct 1 MKLLIVFGLLTSVYCIHKECSI-QECCENQPYQIEDPCPIHY 41 >sp|Q3LZX5|NS8_BCHK3 Non-structural protein 8 OS=Bat coronavirus HKU3 OX=442736 GN=8 PE=3 SV=1 Length=121 Score = 29.2 bits (64), Expect = 0.52, Method: Composition-based stats. Identities = 16/42 (38%), Positives = 25/42 (60%), Gaps = 4/42 (10%) Query 1 MKLLIVLTCISLCSCI---CTVVQRCASNKPHVLEDPCKVQH 39 MKLLIV ++ C C++ Q C N+P+ +EDPC + + Sbjct 1 MKLLIVFGLLASVYCFHRECSI-QECCENQPYQIEDPCPIHY 41 >sp|Q3I5J0|NS7A_BCRP3 Protein 7a OS=Bat coronavirus Rp3/2004 OX=349344 GN=7a PE=3 SV=1 Length=122 Score = 26.5 bits (57), Expect = 5.1, Method: Composition-based stats. Identities = 13/35 (37%), Positives = 20/35 (57%), Gaps = 0/35 (0%) Query 1 MKLLIVLTCISLCSCICTVVQRCASNKPHVLEDPC 35 MK+++ LT I+L SC Q C +L++PC Sbjct 1 MKIILFLTLIALASCELYHYQECVRGTTVLLKEPC 35 >sp|Q3LZX7|NS7A_BCHK3 Protein 7a OS=Bat coronavirus HKU3 OX=442736 GN=7a PE=3 SV=1 Length=122 Score = 25.7 bits (55), Expect = 9.4, Method: Composition-based stats. Identities = 12/35 (34%), Positives = 20/35 (57%), Gaps = 0/35 (0%) Query 1 MKLLIVLTCISLCSCICTVVQRCASNKPHVLEDPC 35 MK+++ LT I+L +C Q C +L++PC Sbjct 1 MKIILFLTLIALATCELYHYQECVRGTTVLLKEPC 35 Lambda K H a alpha 0.319 0.143 0.548 0.792 4.96 Gapped Lambda K H a alpha sigma 0.267 0.0437 0.140 1.90 42.6 43.6 Effective search space used: 5180544980 Search has CONVERGED! Database: uniprot_sprot.fasta Posted date: Apr 3, 2024 12:05 PM Number of letters in database: 206,678,396 Number of sequences in database: 571,282 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40