Contact Molecules for Homologous Proteins | ||||
[Summary Bars] |
[Full Bars] |
|
[Back to Search Page] |
[Back to HOMCOS] |
[Sites by Variants] |
[SupCon3D] |
[help] |
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100] | [show] [download] [help] |
PID | QueryLength | Homolgous Sequence in PDB | UniProt Query | TITLE |
19598 | 4382 | 147 | P0C6U8(R1A_SARS) | RecName: Full=Replicase polyprotein 1a; Short=pp1a;AltName: Full=ORF1a polyprotein;Contains: RecName: Full=Host translation inhibitor nsp1; AltName: Full=Leader protein; AltName: Full=Non-structural protein 1; Short=nsp1;Contains: RecName: Full=Non-structural protein 2; Short=nsp2; AltName: Full=p65 homolog;Contains: RecName: Full=Papain-like protease nsp3; Short=PL-PRO; EC=3.4.19.12 ; EC=3.4.22.- ; AltName: Full=Non-structural protein 3; Short=nsp3; AltName: Full=PL2-PRO;Contains: RecName: Full=Non-structural protein 4; Short=nsp4;Contains: RecName: Full=3C-like proteinase nsp5; Short=3CL-PRO; Short=3CLp; EC=3.4.22.69 ; AltName: Full=Main protease; Short=Mpro; AltName: Full=Non-structural protein 5; Short=nsp5; AltName: Full=SARS coronavirus main proteinase;Contains: RecName: Full=Non-structural protein 6; Short=nsp6;Contains: RecName: Full=Non-structural protein 7; Short=nsp7;Contains: RecName: Full=Non-structural protein 8; Short=nsp8;Contains: RecName: Full=RNA-capping enzyme subunit nsp9; AltName: Full=Non-structural protein 9; Short=nsp9; EC=2.7.7.50;Contains: RecName: Full=Non-structural protein 10; Short=nsp10; AltName: Full=Growth factor-like peptide; Short=GFL;Contains: RecName: Full=Non-structural protein 11; Short=nsp11; |
QUERYSEQ |
MESLVLGVNEKTHVQLSLPVLQVRDVLVRGFGDSVEEALSEAREHLKNGTCGLVELEKGVLPQLEQPYVFIKRSDALSTNHGHKVVELVAEMDGIQYGRSGITLGVLVPHVGETPIAYRNVLLRKNGNKGAGGHSYGIDLKSYDLGDELG TDPIEDYEQNWNTKHGSGALRELTRELNGGAVTRYVDNNFCGPDGYPLDCIKDFLARAGKSMCTLSEQLDYIESKRGVYCCRDHEHEIAWFTERSDKSYEHQTPFEIKSAKKFDTFKGECPKFVFPLNSKVKVIQPRVEKKKTEGFMGRI RSVYPVASPQECNNMHLSTLMKCNHCDEVSWQTCDFLKATCEHCGTENLVIEGPTTCGYLPTNAVVKMPCPACQDPEIGPEHSVADYHNHSNIETRLRKGGRTRCFGGCVFAYVGCYNKRAYWVPRASADIGSGHTGITGDNVETLNEDL LEILSRERVNINIVGDFHLNEEVAIILASFSASTSAFIDTIKSLDYKSFKTIVESCGNYKVTKGKPVKGAWNIGQQRSVLTPLCGFPSQAAGVIRSIFARTLDAANHSIPDLQRAAVTILDGISEQSLRLVDAMVYTSDLLTNSVIIMAY VTGGLVQQTSQWLSNLLGTTVEKLRPIFEWIEAKLSAGVEFLKDAWEILKFLITGVFDIVKGQIQVASDNIKDCVKCFIDVVNKALEMCIDQVTIAGAKLRSLNLGEVFIAQSKGLYRQCIRGKEQLQLLMPLKAPKEVTFLEGDSHDTV LTSEEVVLKNGELEALETPVDSFTNGAIVGTPVCVNGLMLLEIKDKEQYCALSPGLLATNNVFRLKGGAPIKGVTFGEDTVWEVQGYKNVRITFELDERVDKVLNEKCSVYTVESGTEVTEFACVVAEAVVKTLQPVSDLLTNMGIDLDE WSVATFYLFDDAGEENFSSRMYCSFYPPDEEEEDDAECEEEEIDETCEHEYGTEDDYQGLPLEFGASAETVRVEEEEEEDWLDDTTEQSEIEPEPEPTPEEPVNQFTGYLKLTDNVAIKCVDIVKEAQSANPMVIVNAANIHLKHGGGVA GALNKATNGAMQKESDDYIKLNGPLTVGGSCLLSGHNLAKKCLHVVGPNLNAGEDIQLLKAAYENFNSQDILLAPLLSAGIFGAKPLQSLQVCVQTVRTQVYIAVNDKALYEQVVMDYLDNLKPRVEAPKQEEPPNTEDSKTEEKSVVQK PVDVKPKIKACIDEVTTTLEETKFLTNKLLLFADINGKLYHDSQNMLRGEDMSFLEKDAPYMVGDVITSGDITCVVIPSKKAGGTTEMLSRALKKVPVDEYITTYPGQGCAGYTLEEAKTALKKCKSAFYVLPSEAPNAKEEILGTVSWN LREMLAHAEETRKLMPICMDVRAIMATIQRKYKGIKIQEGIVDYGVRFFFYTSKEPVASIITKLNSLNEPLVTMPIGYVTHGFNLEEAARCMRSLKAPAVVSVSSPDAVTTYNGYLTSSSKTSEEHFVETVSLAGSYRDWSYSGQRTELG VEFLKRGDKIVYHTLESPVEFHLDGEVLSLDKLKSLLSLREVKTIKVFTTVDNTNLHTQLVDMSMTYGQQFGPTYLDGADVTKIKPHVNHEGKTFFVLPSDDTLRSEAFEYYHTLDESFLGRYMSALNHTKKWKFPQVGGLTSIKWADNN CYLSSVLLALQQLEVKFNAPALQEAYYRARAGDAANFCALILAYSNKTVGELGDVRETMTHLLQHANLESAKRVLNVVCKHCGQKTTTLTGVEAVMYMGTLSYDNLKTGVSIPCVCGRDATQYLVQQESSFVMMSAPPAEYKLQQGTFLC ANEYTGNYQCGHYTHITAKETLYRIDGAHLTKMSEYKGPVTDVFYKETSYTTTIKPVSYKLDGVTYTEIEPKLDGYYKKDNAYYTEQPIDLVPTQPLPNASFDNFKLTCSNTKFADDLNQMTGFTKPASRELSVTFFPDLNGDVVAIDYR HYSASFKKGAKLLHKPIVWHINQATTKTTFKPNTWCLRCLWSTKPVDTSNSFEVLAVEDTQGMDNLACESQQPTSEEVVENPTIQKEVIECDVKTTEVVGNVILKPSDEGVKVTQELGHEDLMAAYVENTSITIKKPNELSLALGLKTIA THGIAAINSVPWSKILAYVKPFLGQAAITTSNCAKRLAQRVFNNYMPYVFTLLFQLCTFTKSTNSRIRASLPTTIAKNSVKSVAKLCLDAGINYVKSPKFSKLFTIAMWLLLLSICLGSLICVTAAFGVLLSNFGAPSYCNGVRELYLNS SNVTTMDFCEGSFPCSICLSGLDSLDSYPALETIQVTISSYKLDLTILGLAAEWVLAYMLFTKFFYLLGLSAIMQVFFGYFASHFISNSWLMWFIISIVQMAPVSAMVRMYIFFASFYYIWKSYVHIMDGCTSSTCMMCYKRNRATRVEC TTIVNGMKRSFYVYANGGRGFCKTHNWNCLNCDTFCTGSTFISDEVARDLSLQFKRPINPTDQSSYIVDSVAVKNGALHLYFDKAGQKTYERHPLSHFVNLDNLRANNTKGSLPINVIVFDGKSKCDESASKSASVYYSQLMCQPILLLD QALVSDVGDSTEVSVKMFDAYVDTFSATFSVPMEKLKALVATAHSELAKGVALDGVLSTFVSAARQGVVDTDVDTKDVIECLKLSHHSDLEVTGDSCNNFMLTYNKVENMTPRDLGACIDCNARHINAQVAKSHNVSLIWNVKDYMSLSE QLRKQIRSAAKKNNIPFRLTCATTRQVVNVITTKISLKGGKIVSTCFKLMLKATLLCVLAALVCYIVMPVHTLSIHDGYTNEIIGYKAIQDGVTRDIISTDDCFANKHAGFDAWFSQRGGSYKNDKSCPVVAAIITREIGFIVPGLPGTV LRAINGDFLHFLPRVFSAVGNICYTPSKLIEYSDFATSACVLAAECTIFKDAMGKPVPYCYDTNLLEGSISYSELRPDTRYVLMDGSIIQFPNTYLEGSVRVVTTFDAEYCRHGTCERSEVGICLSTSGRWVLNNEHYRALSGVFCGVDA MNLIANIFTPLVQPVGALDVSASVVAGGIIAILVTCAAYYFMKFRRVFGEYNHVVAANALLFLMSFTILCLVPAYSFLPGVYSVFYLYLTFYFTNDVSFLAHLQWFAMFSPIVPFWITAIYVFCISLKHCHWFFNNYLRKRVMFNGVTFS TFEEAALCTFLLNKEMYLKLRSETLLPLTQYNRYLALYNKYKYFSGALDTTSYREAACCHLAKALNDFSNSGADVLYQPPQTSITSAVLQSGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIR KSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLYA AVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCSGVTFQGKFKKIVKGTHHWMLLTFLTSLLILVQSTQWSLFFFVYENAFLPFTLGIMAIAA CAMLLVKHKHAFLCLFLLPSLATVAYFNMVYMPASWVMRIMTWLELADTSLSGYRLKDCVMYASALVLLILMTARTVYDDAARRVWTLMNVITLVYKVYYGNALDQAISMWALVISVTSNYSGVVTTIMFLARAIVFVCVEYYPLLFITG NTLQCIMLVYCFLGYCCCCYFGLFCLLNRYFRLTLGVYDYLVSTQEFRYMNSQGLLPPKSSIDAFKLNIKLLGIGGKPCIKVATVQSKMSDVKCTSVVLLSVLQQLRVESSSKLWAQCVQLHNDILLAKDTTEAFEKMVSLLSVLLSMQG AVDINRLCEEMLDNRATLQAIASEFSSLPSYAAYATAQEAYEQAVANGDSEVVLKKLKKSLNVAKSEFDRDAAMQRKLEKMADQAMTQMYKQARSEDKRAKVTSAMQTMLFTMLRKLDNDALNNIINNARDGCVPLNIIPLTTAAKLMVV VPDYGTYKNTCDGNTFTYASALWEIQQVVDADSKIVQLSEINMDNSPNLAWPLIVTALRANSAVKLQNNELSPVALRQMSCAAGTTQTACTDDNALAYYNNSKGGRFVLALLSDHQDLKWARFPKSDGTGTIYTELEPPCRFVTDTPKGP KVKYLYFIKGLNNLNRGMVLGSLAATVRLQAGNATEVPANSTVLSFCAFAVDPAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQESFGGASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLRNTVCTVC GMWKGYGCSCDQLREPLMQSADASTFLNGFAV |
[n]:site number of query sequence. [a]:amino acid of query sequence. [s]:predicted secondary structure. [e]:predicted exposed/buried. [acc]:predicted relative accesssibility(%). [pdb]:PDB code of homologous structure. [contact_mols]:predicted binding molecules [observed aa]:Observed amino acids among homologous sequences. [feature table]:UniProt Feature Table [variant]:UniProt Human Variant.
n | a | s | e | acc | pdb | contact_mols | observed aa | feature table | variant |
1 | M | - | - | - | - | M |
TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
2 | E | - | - | - | - | E |
TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
3 | S | - | - | - | - | S |
TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
4 | L | - | - | - | - | L |
TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
5 | V | - | - | - | - | VA |
TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
6 | L | - | - | - | - | LP |
TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
7 | G | - | - | - | - | G |
TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
8 | V | - | - | - | - | VFI |
TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
9 | N | - | - | - | - | NS |
TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
10 | E | - | - | - | - | E |
TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
11 | K | - | - | - | - | K |
TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
12 | T | - | - | - | - | TR |
DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" | ||
13 | H | - | - | - | - | H |
DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" | ||
14 | V | - | - | - | - | V |
DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" | ||
15 | Q | - | - | - | - | QAS |
DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" | ||
16 | L | - | - | - | - | LC |
DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" | ||
17 | S | - | - | - | - | STK |
DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" | ||
18 | L | - | - | - | - | LVA |
DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" | ||
19 | P | - | - | - | - | PS |
DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" | ||
20 | V | - | - | - | - | LV |
DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" | ||
21 | L | - | - | - | - | CL |
DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" | ||
22 | Q | - | - | - | - | DQ |
DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" | ||
23 | V | - | - | - | - | VTA |
DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" | ||
24 | R | - | - | - | - | RGDE |
DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" | ||
25 | D | - | - | - | - | D |
DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" | ||
26 | V | - | - | - | - | VML |
DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" | ||
27 | L | - | - | - | - | LV |
DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" | ||
28 | V | - | - | - | - | VTL |
DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" | ||
29 | R | - | - | - | - | RPTK |
DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" | ||
30 | G | - | - | - | - | GW |
DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" | ||
31 | F | - | - | - | - | FW |
DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" | ||
32 | G | - | - | - | - | GEDM |
DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" | ||
33 | D | - | - | - | - | DI |
DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" | ||
34 | S | - | - | - | - | GSP |
DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" | ||
35 | V | - | - | - | - | VILAEGSDFKNPQRTCHMWY |
DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" | ||
36 | E | - | - | - | - | E |
DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" | ||
37 | E | - | - | - | - | ETS |
DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" | ||
38 | A | - | - | - | - | AV |
DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" | ||
39 | L | - | - | - | - | LFY |
DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" | ||
40 | S | - | - | - | - | SNEKA |
DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" | ||
41 | E | - | - | - | - | EQYH |
DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" | ||
42 | A | - | - | - | - | AV |
DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" | ||
43 | R | - | - | - | - | SRK |
DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" | ||
44 | E | - | - | - | - | EQS |
DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" | ||
45 | H | - | - | - | - | HQI |
DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" | ||
46 | L | - | - | - | - | L |
DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" | ||
47 | K | - | - | - | - | KRS |
DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" | ||
48 | N | - | - | - | - | KTNDS |
DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" | ||
49 | G | - | - | - | - | GP |
DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" | ||
50 | T | - | - | - | - | TKES |
DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" | ||
51 | C | - | - | - | - | CIPK |
DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" | ||
52 | G | - | - | - | - | LGQ |
DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" | ||
53 | L | - | - | - | - | LFI |
DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" | ||
54 | V | - | - | - | - | VF |
DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" | ||
55 | E | - | - | - | - | EPFQ |
DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" | ||
56 | L | - | - | - | - | VLMT |
DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" | ||
57 | E | - | - | - | - | EHPL |
DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" | ||
58 | K | - | - | - | - | KQY |
DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" | ||
59 | G | - | - | - | - | GRY |
DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" | ||
60 | V | - | - | - | - | VALF |
DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" | ||
61 | L | - | - | - | - | LMAI |
DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" | ||
62 | P | - | - | - | - | PKR |
DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" | ||
63 | Q | - | - | - | - | QFGH |
DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" | ||
64 | L | - | - | - | - | LIP |
DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" | ||
65 | E | - | - | - | - | PES |
DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" | ||
66 | Q | - | - | - | - | GQ |
DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" | ||
67 | P | - | - | - | - | PD |
DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" | ||
68 | Y | - | - | - | - | RY |
DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" | ||
69 | V | - | - | - | - | V |
DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" | ||
70 | F | - | - | - | - | YFV |
DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" | ||
71 | I | - | - | - | - | IL |
DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" | ||
72 | K | - | - | - | - | VKT |
DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" | ||
73 | R | - | - | - | - | ERD |
DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" | ||
74 | S | - | - | - | - | SR |
DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" | ||
75 | D | - | - | - | - | LDI |
DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" | ||
76 | A | - | - | - | - | TAW |
DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" | ||
77 | L | - | - | - | - | GYLQR |
DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" | ||
78 | S | - | - | - | - | GAST |
DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" | ||
79 | T | - | - | - | - | TMA |
DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" | ||
80 | N | - | - | - | - | NLYPD |
DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" | ||
81 | H | - | - | - | - | SHF |
DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" | ||
82 | G | - | - | - | - | GKD |
DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" | ||
83 | H | - | - | - | - | HQPY |
DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" | ||
84 | K | - | - | - | - | FPKVR |
DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" | ||
85 | V | - | - | - | - | VMLI |
DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" | ||
86 | V | - | - | - | - | VR |
DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" | ||
87 | E | - | - | - | - | EN |
DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" | ||
88 | L | - | - | - | - | LQ |
DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" | ||
89 | V | - | - | - | - | LVA |
DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" | ||
90 | A | - | - | - | - | AM |
DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" | ||
91 | E | - | - | - | - | YED |
DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" | ||
92 | M | - | - | - | - | KLQM |
DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" | ||
93 | D | - | - | - | - | DNE |
DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" | ||
94 | G | - | - | - | - | GA |
DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" | ||
95 | I | - | - | - | - | AIV |
DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" | ||
96 | Q | - | - | - | - | QARG |
DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" | ||
97 | Y | - | - | - | - | YMEF |
DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" | ||
98 | G | - | - | - | - | GM |
DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" | ||
99 | R | - | - | - | - | RV |
DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" | ||
100 | S | - | - | - | - | STGI |
DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" | ||
101 | G | - | - | - | - | GT |
DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" | ||
102 | I | - | - | - | - | LTIKEADFGNPQRSVY |
DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" | ||
103 | T | - | - | - | - | TNP |
DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" | ||
104 | L | - | - | - | - | LHI |
DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" | ||
105 | G | - | - | - | - | G |
DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" | ||
106 | V | - | - | - | - | VM |
DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" | ||
107 | L | - | - | - | - | LF |
DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" | ||
108 | V | - | - | - | - | FVL |
DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" | ||
109 | P | - | - | - | - | P |
DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" | ||
110 | H | - | - | - | - | YHMF |
DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" | ||
111 | V | - | - | - | - | DVQ |
DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" | ||
112 | G | - | - | - | - | GSDIA |
DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" | ||
113 | E | - | - | - | - | ESPD |
DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" | ||
114 | T | - | - | - | - | LTSI |
DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" | ||
115 | P | - | - | - | - | PVEF |
DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" | ||
116 | I | - | - | - | - | TIV |
DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" | ||
117 | A | - | - | - | - | GAM |
DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" | ||
118 | Y | - | - | - | - | YEGK |
DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" | ||
119 | R | - | - | - | - | RDQFHY |
DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" | ||
120 | N | - | - | - | - | NTDQK |
DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" | ||
121 | V | - | - | - | - | IVF |
DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" | ||
122 | L | - | - | - | - | LQ |
DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" | ||
123 | L | - | - | - | - | LI |
DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" | ||
124 | R | - | - | - | - | R |
DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" | ||
125 | K | - | - | - | - | K |
DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" | ||
126 | N | - | - | - | - | NYLADEGIKPRSTVCFHMQ |
DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" | ||
127 | G | - | - | - | - | GLADEIKPRSTVCFHMNQY |
DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp1 globular" TOPO_DOM /note="Cytoplasmic" | ||
128 | N | - | - | - | - | NLRADEGIKPSTVCFHMQY |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
129 | K | - | - | - | - | KGYADEFILNPQRSTV |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
130 | G | - | - | - | - | GADEFIKLNPQRSTV |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
131 | A | - | - | - | - | AQIFDEGKLNPRSTV |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
132 | G | - | - | - | - | GL |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
133 | G | - | - | - | - | GFA |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
134 | H | - | - | - | - | HNRY |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
135 | S | - | - | - | - | SEHR |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
136 | Y | - | - | - | - | YFRP |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
137 | G | - | - | - | - | PGRADEFIKLNQSTV |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
138 | I | - | - | - | - | DIWAEFGKLNPQRSTV |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
139 | D | - | - | - | - | DVTA |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
140 | L | - | - | - | - | LPR |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
141 | K | - | - | - | - | KPFW |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
142 | S | - | - | - | - | SELHD |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
143 | Y | - | - | - | - | YVWF |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
144 | D | - | - | - | - | DE |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
145 | L | - | - | - | - | LIGR |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
146 | G | - | - | - | - | GLFDM |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
147 | D | - | - | - | - | DSNV |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
148 | E | - | - | - | - | DETA |
DOMAIN /note="BetaCoV Nsp1 C-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="BetaCoV Nsp1 C-terminal" TOPO_DOM /note="Cytoplasmic" | ||
149 | L | - | - | - | - | LPS |
DOMAIN /note="BetaCoV Nsp1 C-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="BetaCoV Nsp1 C-terminal" TOPO_DOM /note="Cytoplasmic" | ||
150 | G | - | - | - | - | GEC |
DOMAIN /note="BetaCoV Nsp1 C-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="BetaCoV Nsp1 C-terminal" TOPO_DOM /note="Cytoplasmic" | ||
151 | T | - | - | - | - | PTA |
DOMAIN /note="BetaCoV Nsp1 C-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="BetaCoV Nsp1 C-terminal" TOPO_DOM /note="Cytoplasmic" | ||
152 | D | - | - | - | - | DE |
DOMAIN /note="BetaCoV Nsp1 C-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="BetaCoV Nsp1 C-terminal" TOPO_DOM /note="Cytoplasmic" | ||
153 | P | - | - | - | - | PW |
DOMAIN /note="BetaCoV Nsp1 C-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="BetaCoV Nsp1 C-terminal" TOPO_DOM /note="Cytoplasmic" | ||
154 | I | - | - | - | - | YITMC |
DOMAIN /note="BetaCoV Nsp1 C-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="BetaCoV Nsp1 C-terminal" TOPO_DOM /note="Cytoplasmic" | ||
155 | E | - | - | - | - | EGLD |
DOMAIN /note="BetaCoV Nsp1 C-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="BetaCoV Nsp1 C-terminal" TOPO_DOM /note="Cytoplasmic" | ||
156 | D | - | - | - | - | DK |
DOMAIN /note="BetaCoV Nsp1 C-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="BetaCoV Nsp1 C-terminal" TOPO_DOM /note="Cytoplasmic" | ||
157 | Y | - | - | - | - | YF |
DOMAIN /note="BetaCoV Nsp1 C-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="BetaCoV Nsp1 C-terminal" TOPO_DOM /note="Cytoplasmic" | ||
158 | E | - | - | - | - | ESPQ |
DOMAIN /note="BetaCoV Nsp1 C-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="BetaCoV Nsp1 C-terminal" TOPO_DOM /note="Cytoplasmic" | ||
159 | Q | - | - | - | - | QDAE |
DOMAIN /note="BetaCoV Nsp1 C-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="BetaCoV Nsp1 C-terminal" TOPO_DOM /note="Cytoplasmic" | ||
160 | N | - | - | - | - | NDS |
DOMAIN /note="BetaCoV Nsp1 C-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="BetaCoV Nsp1 C-terminal" TOPO_DOM /note="Cytoplasmic" | ||
161 | W | - | - | - | - | WCPALDEGIKRSTVFHMNQY |
DOMAIN /note="BetaCoV Nsp1 C-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="BetaCoV Nsp1 C-terminal" TOPO_DOM /note="Cytoplasmic" | ||
162 | N | - | - | - | - | KNALDEGIPRSTVCFHMQY |
DOMAIN /note="BetaCoV Nsp1 C-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="BetaCoV Nsp1 C-terminal" TOPO_DOM /note="Cytoplasmic" | ||
163 | T | - | - | - | - | TPGALDEIKRSVCFHMNQY |
DOMAIN /note="BetaCoV Nsp1 C-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="BetaCoV Nsp1 C-terminal" TOPO_DOM /note="Cytoplasmic" | ||
164 | K | - | - | - | - | KALDEGIPRSTVCFHMNQY |
DOMAIN /note="BetaCoV Nsp1 C-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="BetaCoV Nsp1 C-terminal" TOPO_DOM /note="Cytoplasmic" | ||
165 | H | - | - | - | - | HAYLDEGIKPRSTVCFMNQ |
DOMAIN /note="BetaCoV Nsp1 C-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="BetaCoV Nsp1 C-terminal" TOPO_DOM /note="Cytoplasmic" | ||
166 | G | - | - | - | - | GKASLDEIPRTVCFHMNQY |
DOMAIN /note="BetaCoV Nsp1 C-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="BetaCoV Nsp1 C-terminal" TOPO_DOM /note="Cytoplasmic" | ||
167 | S | - | - | - | - | SRQGALDEIKPTVCFHMNY |
DOMAIN /note="BetaCoV Nsp1 C-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="BetaCoV Nsp1 C-terminal" TOPO_DOM /note="Cytoplasmic" | ||
168 | G | - | - | - | - | GNALDEIKPRSTVCFHMQY |
DOMAIN /note="BetaCoV Nsp1 C-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="BetaCoV Nsp1 C-terminal" TOPO_DOM /note="Cytoplasmic" | ||
169 | A | - | - | - | - | VGLADEIKPRSTCFHMNQY |
DOMAIN /note="BetaCoV Nsp1 C-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="BetaCoV Nsp1 C-terminal" TOPO_DOM /note="Cytoplasmic" | ||
170 | L | - | - | - | - | LDTAEGIKPRSVCFHMNQY |
DOMAIN /note="BetaCoV Nsp1 C-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="BetaCoV Nsp1 C-terminal" TOPO_DOM /note="Cytoplasmic" | ||
171 | R | - | - | - | - | RVKALDEGIPSTCFHMNQY |
DOMAIN /note="BetaCoV Nsp1 C-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="BetaCoV Nsp1 C-terminal" TOPO_DOM /note="Cytoplasmic" | ||
172 | E | - | - | - | - | EYKALDGIPRSTVCFHMNQ |
DOMAIN /note="BetaCoV Nsp1 C-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="BetaCoV Nsp1 C-terminal" TOPO_DOM /note="Cytoplasmic" | ||
173 | L | - | - | - | - | L |
DOMAIN /note="BetaCoV Nsp1 C-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="BetaCoV Nsp1 C-terminal" TOPO_DOM /note="Cytoplasmic" | ||
174 | T | - | - | - | - | LISTM |
DOMAIN /note="BetaCoV Nsp1 C-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="BetaCoV Nsp1 C-terminal" TOPO_DOM /note="Cytoplasmic" | ||
175 | R | - | - | - | - | KRDAEFGILNPQSTV |
DOMAIN /note="BetaCoV Nsp1 C-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="BetaCoV Nsp1 C-terminal" TOPO_DOM /note="Cytoplasmic" | ||
176 | E | - | - | - | - | EKQADFGILNPRSTV |
DOMAIN /note="BetaCoV Nsp1 C-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="BetaCoV Nsp1 C-terminal" TOPO_DOM /note="Cytoplasmic" | ||
177 | L | - | - | - | - | LYADEFGIKNPQRSTV |
DOMAIN /note="BetaCoV Nsp1 C-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="BetaCoV Nsp1 C-terminal" TOPO_DOM /note="Cytoplasmic" | ||
178 | N | - | - | - | - | NIGVADEFKLPQRST |
DOMAIN /note="BetaCoV Nsp1 C-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="BetaCoV Nsp1 C-terminal" TOPO_DOM /note="Cytoplasmic" | ||
179 | G | - | - | - | - | GLADEFIKNPQRSTVY |
DOMAIN /note="BetaCoV Nsp1 C-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="BetaCoV Nsp1 C-terminal" TOPO_DOM /note="Cytoplasmic" | ||
180 | G | - | - | - | - | GLADEFIKNPQRSTVY |
SITE /note="Cleavage; by PL-PRO" TOPO_DOM /note="Cytoplasmic" SITE /note="Cleavage; by PL-PRO" TOPO_DOM /note="Cytoplasmic" | ||
181 | A | - | - | - | - | DAVLEFGIKNPQRSTY |
SITE /note="Cleavage; by PL-PRO" TOPO_DOM /note="Cytoplasmic" SITE /note="Cleavage; by PL-PRO" TOPO_DOM /note="Cytoplasmic" | ||
182 | V | - | - | - | - | VCFYLADEGIKNPQRST |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
183 | T | - | - | - | - | TILADEFGKNPQRSVY |
DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
184 | R | - | - | - | - | PRLADEFGIKNQSTVY |
DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
185 | Y | - | - | - | - | YLAGSDEKTVFINPQRCHMW |
DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
186 | V | - | - | - | - | VIF |
DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
187 | D | - | - | - | - | D |
DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
188 | N | - | - | - | - | NQ |
DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
189 | N | - | - | - | - | NY |
DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
190 | F | - | - | - | - | MFLADEGIKNPQRSTVY |
DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
191 | C | - | - | - | - | CLADEFGIKNPQRSTVY |
DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
192 | G | - | - | - | - | GLADEFIKNPQRSTVY |
DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
193 | P | - | - | - | - | PKVLADEFGINQRSTY |
DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
194 | D | - | - | - | - | DNLAEFGIKPQRSTVY |
DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
195 | G | - | - | - | - | G |
DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
196 | Y | - | - | - | - | KYI |
DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
197 | P | - | - | - | - | PL |
DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
198 | L | - | - | - | - | ILV |
DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
199 | D | - | - | - | - | EASD |
DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
200 | C | - | - | - | - | CDPAE |
BINDING /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_label="1" REGION /note="C2H2" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" BINDING /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_label="1" REGION /note="C2H2" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
201 | I | - | - | - | - | YIVF |
REGION /note="C2H2" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" REGION /note="C2H2" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
202 | K | - | - | - | - | AKM |
REGION /note="C2H2" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" REGION /note="C2H2" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
203 | D | - | - | - | - | KDFA |
REGION /note="C2H2" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" REGION /note="C2H2" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
204 | F | - | - | - | - | LIF |
REGION /note="C2H2" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" REGION /note="C2H2" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
205 | L | - | - | - | - | LMV |
REGION /note="C2H2" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" REGION /note="C2H2" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
206 | A | - | - | - | - | AG |
REGION /note="C2H2" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" REGION /note="C2H2" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
207 | R | - | - | - | - | KRVS |
REGION /note="C2H2" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" REGION /note="C2H2" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
208 | A | - | - | - | - | AEID |
REGION /note="C2H2" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" REGION /note="C2H2" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
209 | G | - | - | - | - | GLADEFIKNPQRSTVY |
REGION /note="C2H2" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" REGION /note="C2H2" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
210 | K | - | - | - | - | KTALDEFGINPQRSVY |
REGION /note="C2H2" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" REGION /note="C2H2" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
211 | S | - | - | - | - | SKLADEFGINPQRTVY |
REGION /note="C2H2" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" REGION /note="C2H2" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
212 | M | - | - | - | - | LMDAS |
REGION /note="C2H2" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" REGION /note="C2H2" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
213 | C | - | - | - | - | CTFAD |
REGION /note="C2H2" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" REGION /note="C2H2" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
214 | T | - | - | - | - | TDV |
REGION /note="C2H2" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" REGION /note="C2H2" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
215 | L | - | - | - | - | LVE |
REGION /note="C2H2" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" REGION /note="C2H2" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
216 | S | - | - | - | - | ESA |
REGION /note="C2H2" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" REGION /note="C2H2" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
217 | E | - | - | - | - | EDQA |
REGION /note="C2H2" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" REGION /note="C2H2" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
218 | Q | - | - | - | - | QELDV |
REGION /note="C2H2" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" REGION /note="C2H2" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
219 | L | - | - | - | - | LVK |
REGION /note="C2H2" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" REGION /note="C2H2" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
220 | D | - | - | - | - | DAS |
REGION /note="C2H2" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" REGION /note="C2H2" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
221 | Y | - | - | - | - | AYVRF |
REGION /note="C2H2" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" REGION /note="C2H2" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
222 | I | - | - | - | - | IMLRT |
REGION /note="C2H2" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" REGION /note="C2H2" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
223 | E | - | - | - | - | DEGA |
REGION /note="C2H2" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" REGION /note="C2H2" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
224 | S | - | - | - | - | SKDT |
REGION /note="C2H2" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" REGION /note="C2H2" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
225 | K | - | - | - | - | DKY |
REGION /note="C2H2" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" REGION /note="C2H2" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
226 | R | - | - | - | - | RE |
REGION /note="C2H2" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" REGION /note="C2H2" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
227 | G | - | - | - | - | GFDY |
REGION /note="C2H2" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" REGION /note="C2H2" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
228 | V | - | - | - | - | VIGF |
REGION /note="C2H2" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" REGION /note="C2H2" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
229 | Y | - | - | - | - | YIALDEGKPRSTVCFHMNQ |
REGION /note="C2H2" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" REGION /note="C2H2" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
230 | C | - | - | - | - | CVDT |
REGION /note="C2H2" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" REGION /note="C2H2" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
231 | C | - | - | - | - | LCF |
BINDING /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_label="1" REGION /note="C2H2" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" BINDING /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_label="1" REGION /note="C2H2" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
232 | R | - | - | - | - | RKNP |
REGION /note="C2H2" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" REGION /note="C2H2" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
233 | D | - | - | - | - | DNEK |
REGION /note="C2H2" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" REGION /note="C2H2" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
234 | H | - | - | - | - | HKGN |
BINDING /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_label="1" REGION /note="C2H2" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" BINDING /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_label="1" REGION /note="C2H2" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
235 | E | - | - | - | - | LEYG |
REGION /note="C2H2" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" REGION /note="C2H2" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
236 | H | - | - | - | - | YHV |
BINDING /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_label="1" REGION /note="C2H2" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" BINDING /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_label="1" REGION /note="C2H2" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
237 | E | - | - | - | - | REK |
DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
238 | I | - | - | - | - | IVL |
DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
239 | A | - | - | - | - | VA |
DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
240 | W | - | - | - | - | WI |
DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
241 | F | - | - | - | - | NFKHY |
DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
242 | T | - | - | - | - | VT |
DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
243 | E | - | - | - | - | ETGQ |
DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
244 | R | - | - | - | - | R |
DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
245 | S | - | - | - | - | KSR |
DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
246 | D | - | - | - | - | DENA |
DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
247 | K | - | - | - | - | VK |
DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
248 | S | - | - | - | - | PSA |
DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
249 | Y | - | - | - | - | YV |
DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
250 | E | - | - | - | - | EPSL |
DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
251 | H | - | - | - | - | KHLR |
DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
252 | Q | - | - | - | - | Q |
DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
253 | T | - | - | - | - | TS |
DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
254 | P | - | - | - | - | IPA |
DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
255 | F | - | - | - | - | F |
DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
256 | E | - | - | - | - | TE |
DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
257 | I | - | - | - | - | IVM |
DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
258 | K | - | - | - | - | VKN |
DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
259 | S | - | - | - | - | SGL |
DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
260 | A | - | - | - | - | VAI |
DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
261 | K | - | - | - | - | VKTI |
DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
262 | K | - | - | - | - | QKE |
DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
263 | F | - | - | - | - | FCKLADEGINPQRSTVY |
DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
264 | D | - | - | - | - | DLAEFGIKNPQRSTVY |
DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
265 | T | - | - | - | - | TDGLAEFIKNPQRSVY |
DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
266 | F | - | - | - | - | FVMLAGSDEIKNPQRTCHWY |
DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
267 | K | - | - | - | - | KENLADFGIPQRSTVY |
DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
268 | G | - | - | - | - | GQNDEAIKLPRSTV |
DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
269 | E | - | - | - | - | ESLTD |
DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
270 | C | - | - | - | - | VCP |
DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
271 | P | - | - | - | - | P |
DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
272 | K | - | - | - | - | KEGHRN |
DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
273 | F | - | - | - | - | FYH |
DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
274 | V | - | - | - | - | VTYSADEFGIKLNPQR |
DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
275 | F | - | - | - | - | FY |
DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
276 | P | - | - | - | - | PT |
DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
277 | L | - | - | - | - | LIF |
DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
278 | N | - | - | - | - | GNS |
DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
279 | S | - | - | - | - | STC |
DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
280 | K | - | - | - | - | KQSEI |
DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
281 | V | - | - | - | - | IVS |
DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
282 | K | - | - | - | - | LKVQ |
DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
283 | V | - | - | - | - | VTM |
DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
284 | I | - | - | - | - | IVEL |
DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
285 | Q | - | - | - | - | QSHTA |
DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
286 | P | - | - | - | - | PLADEFGIKNQRSTVY |
DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
287 | R | - | - | - | - | RKSLADEFGINPQTVY |
DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
288 | V | - | - | - | - | VANTLDEFGIKPQRSY |
DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
289 | E | - | - | - | - | TEKA |
DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
290 | K | - | - | - | - | KNWV |
DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
291 | K | - | - | - | - | KNPSQ |
DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
292 | K | - | - | - | - | KTGA |
DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
293 | T | - | - | - | - | NTRVL |
DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
294 | E | - | - | - | - | GEFSD |
DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
295 | G | b | 4.8 | 7fac_A | GNDH |
DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | |||
296 | F | e | 69.4 | 7fac_A | LFP |
DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | |||
297 | M | H | e | 26.1 | 7fac_A | MKVSN |
DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
298 | G | H | e | 52.4 | 7fac_A | GLQ |
DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
299 | R | H | e | 43.5 | 7fac_A | RK |
DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
300 | I | H | b | 0.0 | 7fac_A | IQLV |
DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
301 | R | H | e | 55.3 | 7fac_A | REKHY |
DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
302 | S | H | e | 75.0 | 7fac_A | SLTA |
DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
303 | V | H | e | 23.3 | 7fac_A | VLF |
DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
304 | Y | S | b | 16.1 | 7fac_A | YLADEFGIKNPQRSTV |
DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
305 | P | S | e | 100.0 | 7fac_A | PGTALDEFIKNQRSVY |
DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
306 | V | b | 3.3 | 7fac_A | VFKM |
DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | |||
307 | A | S | e | 51.8 | 7fac_A | AYLDE |
DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
308 | S | S | e | 34.4 | 7fac_A | SGAT |
DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
309 | P | G | b | 6.2 | 7fac_A | PKVL |
DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
310 | Q | G | e | 54.6 | 7fac_A | QYEN |
DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
311 | E | G | e | 42.7 | 7fac_A | EQGS |
DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
312 | C | S | b | 4.0 | 7fac_A | CPTL |
DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
313 | N | E | e | 41.2 | 7fac_A | NGE |
DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
314 | N | E | e | 48.5 | 7fac_A | NYDQ |
DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
315 | M | b | 6.8 | 7fac_A | IMY |
DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | |||
316 | H | b | 8.9 | 7fac_A | YHNC |
DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | |||
317 | L | b | 1.7 | 7fac_A | HLP |
DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | |||
318 | S | E | b | 2.3 | 7fac_A | SA |
DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
319 | T | E | b | 0.0 | 7fac_A | TA |
DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
320 | L | E | e | 28.7 | 7fac_A | LYRF |
DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
321 | M | E | b | 5.8 | 7fac_A | MVLI |
DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
322 | K | E | e | 57.1 | 7fac_A | KDE |
DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
323 | C | b | 0.0 | 7fac_A | metal ZN | C |
BINDING /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_label="2" REGION /note="C4" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" BINDING /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_label="2" REGION /note="C4" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
324 | N | T | e | 80.6 | 7fac_A | NSGTD |
REGION /note="C4" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" REGION /note="C4" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
325 | H | T | e | 69.1 | 7fac_A | HSAY |
REGION /note="C4" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" REGION /note="C4" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
326 | C | T | e | 28.0 | 7fac_A | metal ZN | C |
BINDING /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_label="2" REGION /note="C4" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" BINDING /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_label="2" REGION /note="C4" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | |
327 | D | e | 74.1 | 7fac_A | GD |
REGION /note="C4" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" REGION /note="C4" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | |||
328 | E | e | 59.3 | 7fac_A | ERYNK |
REGION /note="C4" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" REGION /note="C4" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | |||
329 | V | E | e | 54.7 | 7fac_A | GVYDT |
REGION /note="C4" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" REGION /note="C4" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
330 | S | E | b | 6.2 | 7fac_A | STG |
REGION /note="C4" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" REGION /note="C4" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
331 | W | E | b | 11.6 | 7fac_A | W |
REGION /note="C4" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" REGION /note="C4" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
332 | Q | E | b | 0.0 | 7fac_A | QLCT |
REGION /note="C4" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" REGION /note="C4" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
333 | T | E | e | 24.0 | 7fac_A | TP |
REGION /note="C4" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" REGION /note="C4" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
334 | C | E | b | 10.7 | 7fac_A | GCL |
REGION /note="C4" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" REGION /note="C4" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
335 | D | e | 20.4 | 7fac_A | NDK |
REGION /note="C4" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" REGION /note="C4" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | |||
336 | F | S | b | 0.5 | 7fac_A | AFD |
REGION /note="C4" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" REGION /note="C4" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
337 | L | S | e | 31.5 | 7fac_A | ILV |
REGION /note="C4" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" REGION /note="C4" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
338 | K | E | e | 51.9 | 7fac_A | QKG |
REGION /note="C4" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" REGION /note="C4" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
339 | A | E | b | 0.0 | 7fac_A | GAT |
REGION /note="C4" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" REGION /note="C4" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
340 | T | E | e | 33.8 | 7fac_A | FTV |
REGION /note="C4" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" REGION /note="C4" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
341 | C | b | 0.0 | 7fac_A | metal ZN | ACN |
BINDING /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_label="2" REGION /note="C4" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" BINDING /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_label="2" REGION /note="C4" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
342 | E | T | b | 4.0 | 7fac_A | CE |
REGION /note="C4" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" REGION /note="C4" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
343 | H | T | e | 21.5 | 7fac_A | DLQGFH |
REGION /note="C4" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" REGION /note="C4" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
344 | C | T | b | 20.0 | 7fac_A | metal ZN | C |
BINDING /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_label="2" REGION /note="C4" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" BINDING /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_label="2" REGION /note="C4" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | |
345 | G | e | 38.1 | 7fac_A | G |
DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | |||
346 | T | b | 19.5 | 7fac_A | AT |
DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | |||
347 | E | E | e | 68.3 | 7fac_A | ENSH |
DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
348 | N | E | b | 10.9 | 7fac_A | YNLADEFGIKPQRSTV |
DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
349 | L | E | e | 73.0 | 7fac_A | LSTCADEFGIKNPQRVY |
DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
350 | V | e | 29.3 | 7fac_A | AVTLDEFGIKNPQRSY |
DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | |||
351 | I | e | 62.0 | 7fac_A | NFCKIS |
DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | |||
352 | E | S | e | 68.3 | 7fac_A | DEQ |
DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
353 | G | b | 17.9 | 7fac_A | GDLV |
DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | |||
354 | P | e | 24.8 | 7fac_A | LPTEA |
DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | |||
355 | T | E | b | 11.0 | 7fac_A | QTSVN |
DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
356 | T | E | b | 0.0 | 7fac_A | ST |
DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
357 | C | b | 0.0 | 7fac_A | CS |
DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | |||
358 | G | b | 0.0 | 7fac_A | GV |
DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | |||
359 | Y | B | b | 7.8 | 7fac_A | YLDM |
DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
360 | L | e | 33.1 | 7fac_A | LVAI |
DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | |||
361 | P | e | 20.9 | 7fac_A | PEKR |
DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | |||
362 | T | T | e | 68.8 | 7fac_A | KSTPRQA |
DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
363 | N | T | e | 23.0 | 7fac_A | NA |
DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
364 | A | E | b | 0.9 | 7fac_A | AG |
DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
365 | V | E | b | 0.0 | 7fac_A | VL |
DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
366 | V | E | b | 3.3 | 7fac_A | VLFI |
DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
367 | K | E | e | 21.2 | 7fac_A | KLC |
DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
368 | M | E | b | 5.8 | 7fac_A | AMPTI |
DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
369 | P | E | e | 51.2 | 7fac_A | TPNGY |
DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
370 | C | b | 0.0 | 7fac_A | metal ZN | C |
BINDING /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_label="3" REGION /note="C2HC" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" BINDING /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_label="3" REGION /note="C2HC" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
371 | P | H | e | 37.2 | 7fac_A | PV |
REGION /note="C2HC" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" REGION /note="C2HC" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
372 | A | H | b | 0.9 | 7fac_A | metal ZN | ACMF |
REGION /note="C2HC" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" REGION /note="C2HC" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | |
373 | C | H | b | 2.7 | 7fac_A | metal ZN | ACLN |
BINDING /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_label="3" REGION /note="C2HC" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" BINDING /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_label="3" REGION /note="C2HC" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | |
374 | Q | H | e | 52.0 | 7fac_A | KQNLH |
REGION /note="C2HC" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" REGION /note="C2HC" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
375 | D | S | e | 47.5 | 7fac_A | DNG |
REGION /note="C2HC" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" REGION /note="C2HC" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
376 | P | T | e | 93.8 | 7fac_A | GPKDS |
REGION /note="C2HC" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" REGION /note="C2HC" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
377 | E | T | e | 76.4 | 7fac_A | ESA |
REGION /note="C2HC" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" REGION /note="C2HC" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
378 | I | T | e | 26.9 | 7fac_A | CVPI |
REGION /note="C2HC" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" REGION /note="C2HC" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
379 | G | b | 7.1 | 7fac_A | GSALDEIKPRTVCFHMNQY |
REGION /note="C2HC" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" REGION /note="C2HC" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | |||
380 | P | S | e | 69.0 | 7fac_A | PSLAGDEIKRTVFNQYCHMW |
REGION /note="C2HC" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" REGION /note="C2HC" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
381 | E | S | e | 83.4 | 7fac_A | EKSLADFGINPQRTVY |
REGION /note="C2HC" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED REGION /note="C2HC" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
382 | H | e | 23.0 | 7fac_A | metal ZN | HLADEFGIKNPQRSTVY |
BINDING /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_label="3" REGION /note="C2HC" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" BINDING /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_label="3" DISORDER predicted by DISOPRED REGION /note="C2HC" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
383 | S | e | 50.8 | 7fac_A | STNLADEFGIKPQRVY |
REGION /note="C2HC" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED REGION /note="C2HC" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | |||
384 | V | H | e | 34.0 | 7fac_A | VALDEFGIKNPQRSTY |
REGION /note="C2HC" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED REGION /note="C2HC" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
385 | A | H | e | 31.2 | 7fac_A | APLDEFGIKNQRSTVY |
REGION /note="C2HC" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED REGION /note="C2HC" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
386 | D | H | e | 36.4 | 7fac_A | QDELAFGIKNPRSTVY |
REGION /note="C2HC" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED REGION /note="C2HC" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
387 | Y | H | b | 0.4 | 7fac_A | metal ZN | YLVADEFGIKNPQRST |
REGION /note="C2HC" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" REGION /note="C2HC" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | |
388 | H | H | b | 12.0 | 7fac_A | HVYLADEFGIKNPQRST |
REGION /note="C2HC" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" REGION /note="C2HC" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
389 | N | H | e | 56.4 | 7fac_A | NSLADEFGIKPQRTVY |
REGION /note="C2HC" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" REGION /note="C2HC" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
390 | H | H | e | 36.1 | 7fac_A | HIYMELADFGKNPQRSTV |
REGION /note="C2HC" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" REGION /note="C2HC" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
391 | S | S | b | 3.1 | 7fac_A | LSMADEFGIKNPQRTVY |
REGION /note="C2HC" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" REGION /note="C2HC" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
392 | N | e | 75.2 | 7fac_A | NDSTGLAEFIKPQRVY |
REGION /note="C2HC" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" REGION /note="C2HC" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | |||
393 | I | b | 4.1 | 7fac_A | IGEDLAFKNPQRSTVY |
REGION /note="C2HC" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" REGION /note="C2HC" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | |||
394 | E | e | 74.9 | 7fac_A | KERLADFGINPQSTVY |
REGION /note="C2HC" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" REGION /note="C2HC" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | |||
395 | T | e | 26.0 | 7fac_A | TCAM |
REGION /note="C2HC" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" REGION /note="C2HC" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | |||
396 | R | E | e | 58.9 | 7fac_A | RCNDI |
REGION /note="C2HC" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" REGION /note="C2HC" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
397 | L | E | e | 79.2 | 7fac_A | LV |
REGION /note="C2HC" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" REGION /note="C2HC" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
398 | R | e | 42.3 | 7fac_A | IRE |
REGION /note="C2HC" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" REGION /note="C2HC" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | |||
399 | K | S | e | 105.2 | 7fac_A | KVPA |
REGION /note="C2HC" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" REGION /note="C2HC" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
400 | G | S | e | 103.6 | 7fac_A | GDV |
REGION /note="C2HC" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" REGION /note="C2HC" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
401 | G | e | 27.4 | 7fac_A | GNS |
REGION /note="C2HC" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" REGION /note="C2HC" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | |||
402 | R | E | e | 36.0 | 7fac_A | RK |
REGION /note="C2HC" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" REGION /note="C2HC" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
403 | T | E | b | 6.5 | 7fac_A | T |
REGION /note="C2HC" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" REGION /note="C2HC" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
404 | R | E | b | 19.8 | 7fac_A | LYKRI |
REGION /note="C2HC" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" REGION /note="C2HC" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
405 | C | E | e | 43.3 | 7fac_A | TCVIA |
REGION /note="C2HC" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" REGION /note="C2HC" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
406 | F | b | 4.8 | 7fac_A | FY |
REGION /note="C2HC" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" REGION /note="C2HC" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | |||
407 | G | S | b | 2.4 | 7fac_A | G |
REGION /note="C2HC" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" REGION /note="C2HC" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
408 | G | S | e | 33.3 | 7fac_A | G |
REGION /note="C2HC" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" REGION /note="C2HC" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
409 | C | E | b | 0.0 | 7fac_A | VCA |
REGION /note="C2HC" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" REGION /note="C2HC" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
410 | V | E | b | 12.7 | 7fac_A | VIA |
REGION /note="C2HC" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" REGION /note="C2HC" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
411 | F | E | b | 0.0 | 7fac_A | YFW |
REGION /note="C2HC" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" REGION /note="C2HC" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
412 | A | E | b | 6.2 | 7fac_A | AS |
REGION /note="C2HC" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" REGION /note="C2HC" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
413 | Y | E | b | 6.1 | 7fac_A | metal ZN | YP |
REGION /note="C2HC" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" REGION /note="C2HC" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | |
414 | V | E | b | 1.3 | 7fac_A | VMIF |
REGION /note="C2HC" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" REGION /note="C2HC" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
415 | G | E | b | 7.1 | 7fac_A | G |
REGION /note="C2HC" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" REGION /note="C2HC" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
416 | C | E | b | 16.0 | 7fac_A | metal ZN | CK |
BINDING /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_label="3" REGION /note="C2HC" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" BINDING /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_label="3" REGION /note="C2HC" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | |
417 | Y | E | e | 35.7 | 7fac_A | YCVESH |
DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
418 | N | T | e | 57.0 | 7fac_A | NDEG |
DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
419 | K | T | e | 49.5 | 7fac_A | GK |
DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
420 | R | E | e | 41.1 | 7fac_A | TRVC |
DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
421 | A | E | b | 0.0 | 7fac_A | MAT |
DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
422 | Y | E | b | 0.4 | 7fac_A | YVH |
DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
423 | W | E | b | 0.0 | 7fac_A | WF |
DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
424 | V | E | b | 0.0 | 7fac_A | VI |
DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
425 | P | E | b | 10.9 | 7fac_A | P |
DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
426 | R | E | e | 54.9 | 7fac_A | R |
DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
427 | A | E | e | 50.0 | 7fac_A | A |
DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
428 | S | E | e | 43.0 | 7fac_A | KSY |
DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
429 | A | e | 42.0 | 7fac_A | SA |
DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | |||
430 | D | e | 61.7 | 7fac_A | ANIVD |
DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | |||
431 | I | S | b | 19.3 | 7fac_A | IV |
DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
432 | G | B | b | 15.5 | 7fac_A | GFAS |
DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
433 | S | T | e | 22.7 | 7fac_A | TSGAC |
DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
434 | G | T | e | 29.8 | 7fac_A | GEINS |
DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
435 | H | B | b | 0.0 | 7fac_A | HCF |
DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
436 | T | b | 1.9 | 7fac_A | TS |
DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | |||
437 | G | b | 2.4 | 7fac_A | G |
DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | |||
438 | I | E | b | 5.8 | 7fac_A | TIACV |
DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
439 | T | E | e | 39.6 | 7fac_A | TWV |
DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
440 | G | S | e | 36.9 | 7fac_A | GDS |
DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
441 | D | T | e | 72.8 | 7fac_A | KSDEN |
DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
442 | N | T | e | 88.5 | 7fac_A | VNDKG |
DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
443 | V | T | b | 16.7 | 7fac_A | VTCS |
DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
444 | E | H | e | 60.3 | 7fac_A | EVT |
DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
445 | T | H | e | 70.8 | 7fac_A | TAQG |
DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
446 | L | H | e | 35.4 | 7fac_A | ILA |
DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
447 | N | H | b | 12.7 | 7fac_A | NA |
DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
448 | E | H | e | 48.7 | 7fac_A | EKNLDAFGIPQRSTVY |
DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
449 | D | H | e | 61.1 | 7fac_A | DEMNALGIKPRSTVCFHQY |
DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
450 | L | H | b | 1.1 | 7fac_A | LFADEGIKPRSTVCHMNQY |
DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
451 | L | H | e | 34.3 | 7fac_A | LVMADEGIKPRSTCFHNQY |
DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
452 | E | H | e | 59.8 | 7fac_A | ELADGIKNPQRSTV |
DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
453 | I | H | b | 11.7 | 7fac_A | IFYADEGKLNPQRSTV |
DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
454 | L | H | b | 0.6 | 7fac_A | LADEFGIKNPQRSTV |
DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
455 | S | S | e | 53.1 | 7fac_A | EINSQADFGKLPRTV |
DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
456 | R | S | e | 35.6 | 7fac_A | RKEQ |
DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 N-terminal" TOPO_DOM /note="Cytoplasmic" | ||
457 | E | S | e | 73.4 | 7fac_A | AETDLFGIKNPQRSVY |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
458 | R | S | e | 58.9 | 7fac_A | QRKLADEFGINPSTVY |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
459 | V | E | b | 0.0 | 7fac_A | HVRLADEFGIKNPQSTY |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
460 | N | E | b | 1.8 | 7fac_A | SNGA |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
461 | I | E | b | 0.0 | 7fac_A | IL |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
462 | N | E | b | 0.0 | 7fac_A | NR |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
463 | I | E | b | 2.9 | 7fac_A | FIV |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
464 | V | e | 24.0 | 7fac_A | VCD |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | |||
465 | G | S | e | 45.2 | 7fac_A | GQAN |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
466 | D | S | e | 79.6 | 7fac_A | DEQ |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
467 | F | b | 11.5 | 7fac_A | FT |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | |||
468 | H | e | 33.5 | 7fac_A | VALHKQR |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | |||
469 | L | b | 1.7 | 7fac_A | LDVF |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | |||
470 | N | b | 6.7 | 7fac_A | NT |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | |||
471 | E | H | b | 18.6 | 7fac_A | EPD |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
472 | E | H | b | 3.5 | 7fac_A | ETVALDFGIKNPQRSY |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
473 | V | H | b | 0.7 | 7fac_A | VCIALDEFGKNPQRSTY |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
474 | A | H | b | 0.0 | 7fac_A | ALVDEFGIKNPQRSTY |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
475 | I | H | b | 0.0 | 7fac_A | IAVT |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
476 | I | H | b | 0.0 | 7fac_A | IVFL |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
477 | L | H | b | 3.4 | 7fac_A | LI |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
478 | A | H | b | 0.0 | 7fac_A | AS |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
479 | S | T | b | 18.0 | 7fac_A | SGIN |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
480 | F | T | e | 26.8 | 7fac_A | LFT |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
481 | S | b | 11.7 | 7fac_A | STD |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | |||
482 | A | S | e | 91.1 | 7fac_A | AGCTS |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
483 | S | S | e | 39.8 | 7fac_A | STDN |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
484 | T | H | b | 5.8 | 7fac_A | TVIP |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
485 | S | H | e | 39.8 | 7fac_A | SKDEC |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
486 | A | H | e | 36.6 | 7fac_A | ATKE |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
487 | F | H | b | 0.0 | 7fac_A | FVIL |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
488 | I | H | b | 7.6 | 7fac_A | VREI |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
489 | D | H | e | 72.2 | 7fac_A | EDHQ |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
490 | T | H | e | 42.2 | 7fac_A | TL |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
491 | I | H | b | 0.0 | 7fac_A | VRLCI |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
492 | K | T | e | 43.9 | 7fac_A | KDER |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
493 | S | T | e | 68.0 | 7fac_A | GSLN |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
494 | L | b | 10.7 | 7fac_A | LCVA |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | |||
495 | D | e | 48.1 | 7fac_A | DTHQ |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | |||
496 | Y | H | b | 17.0 | 7fac_A | YNLFADEGIKPQRSTV |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
497 | K | H | e | 51.9 | 7fac_A | KADELFGINPQRSTVY |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
498 | S | H | e | 23.4 | 7fac_A | SKATLDEFGINPQRVY |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
499 | F | H | b | 0.0 | 7fac_A | FYLVADEGIKNPQRST |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
500 | K | H | e | 25.5 | 7fac_A | KRELADFGINPQSTVY |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
501 | T | H | e | 40.9 | 7fac_A | DKTQVLAEFGINPRSY |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
502 | I | H | e | 28.1 | 7fac_A | IYVLADEFGKNPQRST |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
503 | V | H | b | 0.0 | 7fac_A | VLRADEFGIKNPQSTY |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
504 | E | H | e | 35.7 | 7fac_A | EDGAT |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
505 | S | H | e | 79.7 | 7fac_A | SHLDP |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
506 | C | T | e | 44.7 | 7fac_A | CLYR |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
507 | G | S | e | 32.1 | 7fac_A | GVLADEFIKNPQRST |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
508 | N | S | e | 36.4 | 7fac_A | NADEGIKLPQRSTV |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
509 | Y | E | b | 8.7 | 7fac_A | FNYVW |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
510 | K | E | e | 47.2 | 7fac_A | KVAI |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
511 | V | E | b | 4.7 | 7fac_A | VI |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
512 | T | E | b | 19.5 | 7fac_A | TM |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
513 | K | e | 43.4 | 7fac_A | KILAMNR |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | |||
514 | G | e | 38.1 | 7fac_A | G |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | |||
515 | K | S | e | 66.0 | 7fac_A | KDPSR |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
516 | P | S | e | 55.8 | 7fac_A | PYAF |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
517 | V | e | 65.3 | 7fac_A | ILKMV |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | |||
518 | K | e | 41.5 | 7fac_A | KRPDET |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | |||
519 | G | S | e | 59.5 | 7fac_A | GDNLAEFIKPQRSTVY |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
520 | A | S | b | 4.5 | 7fac_A | AVLDEFGIKNPQRSTY |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
521 | W | E | b | 0.0 | 7fac_A | IWLADEFGKNPQRSTVY |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
522 | N | E | e | 24.8 | 7fac_A | NLADEFGIKPQRSTVY |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
523 | I | E | b | 1.8 | 7fac_A | IVT |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
524 | G | e | 35.7 | 7fac_A | GD |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | |||
525 | Q | S | e | 49.5 | 7fac_A | QAE |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
526 | Q | e | 85.2 | 7fac_A | QNFYEHADGIKLPRSTV |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | |||
527 | R | e | 51.0 | 7fac_A | AHRKGLSDEFIMNPQTVY |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | |||
528 | S | e | 44.5 | 7fac_A | SPAGTDEIKLNQRV |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | |||
529 | V | S | b | 0.0 | 7fac_A | IVFADEGKLNPQRST |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
530 | L | b | 9.6 | 7fac_A | LITNCADEGKPQRSV |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | |||
531 | T | S | e | 26.0 | 7fac_A | ATVNS |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
532 | P | G | b | 1.6 | 7fac_A | PGA |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
533 | L | G | b | 6.2 | 7fac_A | LVFT |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
534 | C | G | b | 0.0 | 7fac_A | CITYLADEFGKNPQRSV |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
535 | G | b | 0.0 | 7fac_A | GAN |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | |||
536 | F | b | 3.3 | 7fac_A | FAYL |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | |||
537 | P | e | 24.8 | 7fac_A | PAHGT |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | |||
538 | S | S | b | 19.5 | 7fac_A | SVELFG |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
539 | Q | H | e | 65.8 | 7fac_A | QSNIKE |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
540 | A | H | b | 0.0 | 7fac_A | ARFV |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
541 | A | H | b | 0.0 | 7fac_A | AKPF |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
542 | G | H | b | 17.9 | 7fac_A | GCKFATR |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
543 | V | H | b | 2.7 | 7fac_A | VIWG |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
544 | I | H | b | 0.0 | 7fac_A | VIYLP |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
545 | R | H | b | 2.8 | 7fac_A | RGCLW |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
546 | S | H | b | 13.3 | 7fac_A | SANEK |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
547 | I | H | b | 0.0 | 7fac_A | ISLG |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
548 | F | T | b | 4.8 | 7fac_A | FAVLC |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
549 | A | T | b | 3.6 | 7fac_A | SKGAT |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
550 | R | b | 16.2 | 7fac_A | RDEKN |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | |||
551 | T | e | 64.3 | 7fac_A | TSLVA |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | |||
552 | L | b | 15.7 | 7fac_A | LFKS |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | |||
553 | D | e | 70.4 | 7fac_A | EDTKAS |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | |||
554 | A | b | 8.9 | 7fac_A | ATYKI |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | |||
555 | A | T | e | 49.1 | 7fac_A | AFYVLP |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
556 | N | T | e | 103.0 | 7fac_A | ANRDWQ |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
557 | H | e | 46.6 | 7fac_A | HAKYNLDEFGIPQRSTV |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | |||
558 | S | e | 22.7 | 7fac_A | STIYLADEFGKNPQRV |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | |||
559 | I | H | b | 0.0 | 7fac_A | IVCPLADEFGKNQRSTY |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
560 | P | H | b | 17.8 | 7fac_A | SPWRLADEGIKNTVCFHMQY |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
561 | D | H | e | 42.6 | 7fac_A | DNKVAEFGILPQRST |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
562 | L | H | b | 1.1 | 7fac_A | LFI |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
563 | Q | H | e | 21.9 | 7fac_A | QVYCKM |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
564 | R | H | e | 58.5 | 7fac_A | RSFK |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
565 | A | H | e | 31.2 | 7fac_A | ATVSR |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
566 | A | H | b | 0.0 | 7fac_A | AEFLVDGIKPRST |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
567 | V | H | e | 25.3 | 7fac_A | EVIPRFADGKLST |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
568 | T | H | e | 64.9 | 7fac_A | TEYDAGIKLPRSV |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
569 | I | H | e | 40.4 | 7fac_A | ILTRDAEGSV |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
570 | L | H | b | 0.0 | 7fac_A | LFMP |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
571 | D | H | e | 45.7 | 7fac_A | DAC |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
572 | G | H | e | 86.9 | 7fac_A | GQHDYS |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
573 | I | H | b | 19.3 | 7fac_A | ILVYF |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
574 | S | b | 12.5 | 7fac_A | SVFAN |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | |||
575 | E | T | e | 76.9 | 7fac_A | PSEDGQ |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
576 | Q | T | b | 18.4 | 7fac_A | RFQKSNY |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
577 | S | H | b | 0.0 | 7fac_A | SVI |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
578 | L | H | b | 18.0 | 7fac_A | LYECTM |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
579 | R | H | e | 49.8 | 7fac_A | YRLAF |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
580 | L | H | b | 0.0 | 7fac_A | LRP |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
581 | V | H | b | 0.0 | 7fac_A | IVFL |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
582 | D | H | e | 30.9 | 7fac_A | DKN |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
583 | A | H | b | 5.4 | 7fac_A | ASCVG |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
584 | M | H | b | 0.0 | 7fac_A | MCVTGS |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
585 | V | H | b | 0.7 | 7fac_A | VDKNMAEGILPRST |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
586 | Y | H | e | 33.9 | 7fac_A | YNFLADEGIKPRSTV |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
587 | T | H | e | 32.5 | 7fac_A | TFLVADEGIKNPRS |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
588 | S | H | b | 8.6 | 7fac_A | SAELDFGIKNPQRTVY |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
589 | D | e | 30.2 | 7fac_A | DLHYRNAEGSV |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | |||
590 | L | b | 0.0 | 7fac_A | LETAGSV |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | |||
591 | L | e | 27.0 | 7fac_A | LVTADEGIKNPRS |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | |||
592 | T | b | 7.8 | 7fac_A | TDGAVEIKLNPRS |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | |||
593 | N | e | 66.7 | 7fac_A | NDCRTAEGIKLPSV |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | |||
594 | S | b | 11.7 | 7fac_A | SMVAGN |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | |||
595 | V | H | e | 24.0 | 7fac_A | VCTKLY |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
596 | I | H | b | 1.2 | 7fac_A | LMIVAF |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
597 | I | H | b | 0.0 | 7fac_A | VDTFSI |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
598 | M | H | b | 0.0 | 7fac_A | MSTLV |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
599 | A | H | b | 0.0 | 7fac_A | AYR |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
600 | Y | H | b | 15.7 | 7fac_A | YLF |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
601 | V | H | b | 2.0 | 7fac_A | VLFI |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
602 | T | H | b | 0.0 | 7fac_A | LTFV |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
603 | G | S | b | 1.2 | 7fac_A | GMRNA |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
604 | G | S | e | 39.3 | 7fac_A | GHTLRY |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
605 | L | b | 0.0 | 7fac_A | LDVAY |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | |||
606 | V | H | b | 18.0 | 7fac_A | VIQDS |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
607 | Q | H | e | 57.1 | 7fac_A | QDKAEN |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
608 | Q | H | e | 20.4 | 7fac_A | KVQEAL |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
609 | T | H | b | 0.0 | 7fac_A | TASKCFI |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
610 | S | H | b | 14.8 | 7fac_A | TSKGVDQM |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
611 | Q | H | e | 55.1 | 7fac_A | QDKTE |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
612 | W | H | b | 13.1 | 7fac_A | WAYFQV |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
613 | L | H | b | 0.0 | 7fac_A | LVFM |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
614 | S | H | e | 28.1 | 7fac_A | SGKT |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
615 | N | H | e | 84.8 | 7fac_A | NKTGS |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
616 | L | H | e | 22.5 | 7fac_A | VLIMF |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
617 | L | H | b | 2.8 | 7fac_A | LTAIVFS |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
618 | G | T | e | 46.4 | 7fac_A | GATFNSD |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
619 | T | S | b | 13.0 | 7fac_A | TKAIS |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
620 | T | e | 46.1 | 7fac_A | TVACLS |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | |||
621 | V | b | 8.7 | 7fac_A | VLCQYA |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | |||
622 | E | G | e | 48.7 | 7fac_A | ADESQTVGIKLNPR |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
623 | K | G | e | 49.5 | 7fac_A | KAVMSRDEGILNPT |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
624 | L | G | b | 0.0 | 7fac_A | LVAS |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
625 | R | H | e | 57.7 | 7fac_A | RKNDVS |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
626 | P | H | e | 54.3 | 7fac_A | PKTASGL |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
627 | I | H | b | 0.0 | 7fac_A | IVMACFGL |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
628 | F | H | b | 12.9 | 7fac_A | FLTVAG |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
629 | E | H | e | 62.8 | 7fac_A | ENTDAFGIKLPQRSVY |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
630 | W | H | e | 24.7 | 7fac_A | WADEFGIKLNPQRSTVY |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
631 | I | H | b | 0.0 | 7fac_A | FVTILCAG |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
632 | E | H | e | 49.7 | 7fac_A | EDLNQVAG |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
633 | A | H | e | 48.2 | 7fac_A | AKTLEDFGINPQRSVY |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
634 | K | H | e | 33.0 | 7fac_A | KAMTCDEFGILNPQRSVY |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
635 | L | H | b | 0.0 | 7fac_A | LMFVSAG |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
636 | S | H | e | 54.7 | 7fac_A | SDNAKRGL |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
637 | A | T | e | 40.2 | 7fac_A | AITVEDGKLPRS |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
638 | G | T | b | 2.4 | 7fac_A | GATSDEIKLPRV |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
639 | V | H | e | 42.7 | 7fac_A | AVIGLSDEFKNPQRTY |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
640 | E | H | e | 76.4 | 7fac_A | EGPASKLDFINQRTVY |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
641 | F | H | b | 2.4 | 7fac_A | FALDEGIKPRSTVCHMNQY |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
642 | L | H | b | 0.0 | 7fac_A | LISADEGKPRTVCFHMNQY |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
643 | K | H | e | 56.6 | 7fac_A | AKRSLN |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
644 | D | H | e | 39.5 | 7fac_A | DAGT |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
645 | A | H | b | 0.0 | 7fac_A | GAML |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
646 | W | H | b | 2.8 | 7fac_A | WFA |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
647 | E | H | e | 28.1 | 7fac_A | ELKGTADINPRSV |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
648 | I | H | b | 0.6 | 7fac_A | LICG |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
649 | L | H | b | 1.1 | 7fac_A | LFYIV |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
650 | K | H | b | 5.7 | 7fac_A | KQLYR |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
651 | F | H | b | 5.3 | 7fac_A | FVAQILDEGKNPRSTY |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
652 | L | H | b | 11.2 | 7fac_A | LFVI |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
653 | I | H | e | 32.2 | 7fac_A | VLSMIF |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
654 | T | H | e | 52.6 | 7fac_A | NTHKRE |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
655 | G | e | 29.8 | 7fac_A | GKANRC |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | |||
656 | V | e | 66.0 | 7fac_A | LAVQ |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | |||
657 | F | E | e | 21.5 | 7fac_A | FYC |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
658 | D | E | e | 48.1 | 7fac_A | VADTE |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
659 | I | E | b | 12.9 | 7fac_A | VYI |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
660 | V | E | e | 23.3 | 7fac_A | TVASI |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
661 | K | T | e | 37.3 | 7fac_A | SKNQG |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
662 | G | T | b | 0.0 | 7fac_A | GAQV |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
663 | Q | E | e | 20.9 | 7fac_A | GQVYKN |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
664 | I | E | b | 1.8 | 7fac_A | IFV |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
665 | Q | E | e | 52.0 | 7fac_A | QVTAN |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
666 | V | E | e | 31.3 | 7fac_A | VFT |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
667 | A | S | e | 67.9 | 7fac_A | VALCI |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
668 | S | e | 47.7 | 7fac_A | ASEQRNGT |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | |||
669 | D | S | e | 96.9 | 7fac_A | DEHAGKILNPRSTV |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
670 | N | e | 89.1 | 7fac_A | SNLKYEADFGIPQRTV |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | |||
671 | I | e | 27.5 | 7fac_A | IVSL |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | |||
672 | K | e | 53.8 | 7fac_A | KPSN |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | |||
673 | D | H | e | 86.4 | 7fac_A | EDSTQAFGIKLNPRV |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
674 | C | H | b | 13.3 | 7fac_A | LCIKYS |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
675 | V | H | b | 3.3 | 7fac_A | VACL |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
676 | K | H | e | 53.3 | 7fac_A | KQH |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
677 | C | H | e | 40.7 | 7fac_A | QNISCTA |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
678 | F | H | b | 0.0 | 7fac_A | FVL |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
679 | I | H | b | 5.8 | 7fac_A | VLCMFI |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
680 | D | H | e | 45.7 | 7fac_A | DNHKG |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
681 | V | H | b | 17.3 | 7fac_A | KLIV |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
682 | V | H | b | 0.0 | 7fac_A | LFVM |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
683 | N | H | b | 6.7 | 7fac_A | NSKTY |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
684 | K | H | e | 52.8 | 7fac_A | KTAV |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
685 | A | H | b | 3.6 | 7fac_A | AFIG |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
686 | L | H | b | 0.6 | 7fac_A | MFL |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
687 | E | H | e | 48.2 | 7fac_A | KQESA |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
688 | M | H | e | 65.7 | 7fac_A | LVMK |
DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 middle" TOPO_DOM /note="Cytoplasmic" | ||
689 | C | T | b | 4.7 | 7fac_A | LC |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
690 | I | e | 29.8 | 7fac_A | HILA |
DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" | |||
691 | D | e | 61.7 | 7fac_A | TDE |
DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" | |||
692 | Q | E | e | 52.6 | 7fac_A | SQNCKT |
DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" | ||
693 | V | E | e | 24.0 | 7fac_A | VMI |
DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" | ||
694 | T | E | e | 55.8 | 7fac_A | STIK |
DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" | ||
695 | I | E | b | 9.4 | 7fac_A | WVI |
DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" | ||
696 | A | T | e | 47.3 | 7fac_A | ASDG |
DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" | ||
697 | G | T | e | 35.7 | 7fac_A | GV |
DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" | ||
698 | A | E | b | 11.6 | 7fac_A | LASTC |
DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" | ||
699 | K | E | e | 70.8 | 7fac_A | KTN |
DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" | ||
700 | L | E | b | 0.0 | 7fac_A | LVI |
DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" | ||
701 | R | E | e | 23.3 | 7fac_A | SKVRDP |
DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" | ||
702 | S | E | b | 3.9 | 7fac_A | AKST |
DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" | ||
703 | L | E | b | 0.0 | 7fac_A | LITV |
DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" | ||
704 | N | E | e | 26.7 | 7fac_A | NAYI |
DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" | ||
705 | L | S | b | 0.0 | 7fac_A | SLTVYG |
DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" | ||
706 | G | S | e | 73.8 | 7fac_A | GNSR |
DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" | ||
707 | E | S | e | 40.2 | 7fac_A | ETRND |
DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" | ||
708 | V | E | e | 54.0 | 7fac_A | VYSKT |
DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" | ||
709 | F | E | b | 1.0 | 7fac_A | FCLY |
DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" | ||
710 | I | E | b | 2.3 | 7fac_A | IYLVC |
DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" | ||
711 | A | b | 0.9 | 7fac_A | AFLNT |
DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" | |||
712 | Q | S | b | 7.7 | 7fac_A | SGPQVH |
DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" | ||
713 | S | S | b | 3.9 | 7fac_A | STRC |
DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" | ||
714 | K | B | e | 31.6 | 7fac_A | KGTR |
DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" | ||
715 | G | S | b | 4.8 | 7fac_A | GTALDEFIKNPQRSVY |
DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" | ||
716 | L | b | 10.7 | 7fac_A | LVYKAG |
DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" | |||
717 | Y | B | b | 0.0 | 7fac_A | YLTADEFGIKNPQRSV |
DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" | ||
718 | R | B | e | 26.9 | 7fac_A | RCETLADFGIKNPQSVY |
DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" | ||
719 | Q | e | 37.2 | 7fac_A | QVKELADGIPRSTCFHMNY |
DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" | |||
720 | C | e | 33.3 | 7fac_A | CTVSAGLDEIKNPQRFHMWY |
DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" | |||
721 | I | e | 40.9 | 7fac_A | IVTQLAG |
DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" | |||
722 | R | e | 58.9 | 7fac_A | VKRQLPAG |
DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" | |||
723 | G | e | 25.0 | 7fac_A | GQCASL |
DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" | |||
724 | K | S | b | 6.6 | 7fac_A | KRAEGLSVDFHIMNPQTY |
DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" | ||
725 | E | T | e | 59.8 | 7fac_A | EDSKQRLAFGINPTVY |
DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" | ||
726 | Q | T | e | 98.0 | 7fac_A | QLRDEAGIKNPSTV |
DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" | ||
727 | L | b | 18.0 | 7fac_A | LSMFTPADEGIKNRV |
DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" | |||
728 | Q | S | e | 82.1 | 7fac_A | ADGQNEIKLPRSTV |
DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" | ||
729 | L | S | b | 18.0 | 7fac_A | LYFV |
DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" | ||
730 | L | e | 76.4 | 7fac_A | VLIT |
DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" | |||
731 | M | e | 23.2 | 7fac_A | MLI |
DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" | |||
732 | P | e | 51.9 | 7fac_A | P |
DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" | |||
733 | L | e | 68.0 | 7fac_A | GLVQKC |
DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" | |||
734 | K | e | 80.7 | 7fac_A | KDGQNER |
DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" | |||
735 | A | S | b | 18.8 | 7fac_A | ASCYQ |
DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" | ||
736 | P | e | 65.1 | 7fac_A | KPNEADFGILQRSTVY |
DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" | |||
737 | K | S | e | 44.3 | 7fac_A | KQSMN |
DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" | ||
738 | E | e | 64.8 | 7fac_A | EQK |
DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" | |||
739 | V | b | 4.7 | 7fac_A | VIAPTL |
DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" | |||
740 | T | b | 6.5 | 7fac_A | TIGLEY |
DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" | |||
741 | F | b | 2.4 | 7fac_A | FCYGVLI |
DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" | |||
742 | L | b | 2.2 | 7fac_A | LFI |
DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" | |||
743 | E | B | e | 37.7 | 7fac_A | EVKNDQ |
DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" | ||
744 | G | S | e | 28.6 | 7fac_A | GPA |
DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" | ||
745 | D | e | 64.2 | 7fac_A | DETSAGIKLPRV |
DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" | |||
746 | S | E | e | 39.8 | 7fac_A | TIGSFDPAEKLRV |
DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" | ||
747 | H | E | e | 25.7 | 7fac_A | ENHSIDLAGKPRTV |
DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" | ||
748 | D | e | 72.8 | 7fac_A | DPSAEGIKLRTV |
DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" | |||
749 | T | E | b | 8.4 | 7fac_A | TAFVPDEGIKLRS |
DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" | ||
750 | V | E | e | 48.7 | 7fac_A | VTSENADGIKLPR |
DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" | ||
751 | L | e | 34.3 | 7fac_A | LVFADEGIKPRST |
DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" | |||
752 | T | S | e | 68.2 | 7fac_A | TEANVSDL |
DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" | ||
753 | S | e | 47.7 | 7fac_A | DSAVKT |
DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" | |||
754 | E | e | 44.7 | 7fac_A | ETDSLK |
DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" | |||
755 | E | e | 66.8 | 7fac_A | EVS |
DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" | |||
756 | V | b | 14.7 | 7fac_A | VLT |
DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" | |||
757 | V | E | e | 36.7 | 7fac_A | VDEI |
DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" | ||
758 | L | E | e | 30.3 | 7fac_A | VLE |
DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" | ||
759 | K | E | e | 57.5 | 7fac_A | VKCEGALS |
DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" | ||
760 | N | e | 52.1 | 7fac_A | TKHNDQSAGL |
DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" | |||
761 | G | S | e | 47.6 | 7fac_A | GATDL |
DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" | ||
762 | E | e | 63.3 | 7fac_A | EVQPSD |
DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" | |||
763 | L | E | b | 12.4 | 7fac_A | LIQ |
DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" | ||
764 | E | E | e | 31.7 | 7fac_A | EQTADFGIKLNPRSV |
DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" | ||
765 | A | E | e | 26.8 | 7fac_A | NGAEPLDIKRSTVCFHMQY |
DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" | ||
766 | L | E | e | 25.3 | 7fac_A | LVCMADEGIKPRSTFHNQY |
DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" | ||
767 | E | e | 41.7 | 7fac_A | ECFKHALDGIPRSTVMNQY |
DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" | |||
768 | T | e | 26.6 | 7fac_A | TSKGQALDEFINPRVY |
DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" | |||
769 | P | e | 46.5 | 7fac_A | PAS |
DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" | |||
770 | V | H | b | 4.7 | 7fac_A | TPCSVLIAEGK |
DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" | ||
771 | D | H | e | 52.5 | 7fac_A | DSNTKAGLEFIPQRVY |
DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" | ||
772 | S | H | e | 63.3 | 7fac_A | SEGVAKLT |
DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" | ||
773 | F | H | e | 47.4 | 7fac_A | FYHALDEGIKNPQRSTV |
DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" | ||
774 | T | e | 22.7 | 7fac_A | ESTGVALDFIKNPQRY |
DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" | |||
775 | N | S | e | 83.0 | 7fac_A | PEKNYSALDFGIQRTV |
DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" | ||
776 | G | S | e | 59.5 | 7fac_A | PIGSKDEA |
DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" | ||
777 | A | e | 59.8 | 7fac_A | LPCAMKV |
DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" | |||
778 | I | E | b | 10.5 | 7fac_A | IVKSL |
DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" | ||
779 | V | E | e | 41.3 | 7fac_A | VKI |
DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" | ||
780 | G | b | 3.6 | 7fac_A | GAEDFIKLNPQRSTVY |
DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" | |||
781 | T | E | b | 16.9 | 7fac_A | TDNKAEFGILPQRSVY |
DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" | ||
782 | P | E | b | 10.1 | 7fac_A | YPKLIADEFGNQRSTV |
DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" | ||
783 | V | E | b | 2.0 | 7fac_A | VICADEFGKLNPQRSTY |
DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" | ||
784 | C | E | b | 6.0 | 7fac_A | CILSADEFGKNPQRTVY |
DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" | ||
785 | V | E | b | 2.7 | 7fac_A | IVLADEFGKNPQRSTY |
DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" | ||
786 | N | S | e | 43.0 | 7fac_A | DNSA |
DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" | ||
787 | G | S | b | 19.0 | 7fac_A | KNGDSE |
DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" | ||
788 | L | S | b | 3.9 | 7fac_A | LKVMI |
DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" | ||
789 | M | E | b | 8.2 | 7fac_A | YLMF |
DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" | ||
790 | L | E | b | 0.0 | 7fac_A | MFLV |
DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" | ||
791 | L | E | b | 1.1 | 7fac_A | VALGR |
DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" | ||
792 | E | E | b | 16.1 | 7fac_A | KRES |
DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" | ||
793 | I | e | 41.5 | 7fac_A | CTAISLV |
DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" | |||
794 | K | S | e | 57.1 | 7fac_A | GEKD |
DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" | ||
795 | D | S | e | 69.8 | 7fac_A | DEAN |
DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" | ||
796 | K | S | e | 26.9 | 7fac_A | KEQGSTN |
DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" | ||
797 | E | S | e | 43.2 | 7fac_A | EFYDAGIKLPRSTV |
DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" | ||
798 | Q | E | b | 9.7 | 7fac_A | YQFLGTKADEIPRSV |
DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" | ||
799 | Y | E | b | 14.8 | 7fac_A | YPFADEGIKLRSTV |
DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" | ||
800 | C | E | b | 2.7 | 7fac_A | VCPRALDEFGIKNQSTY |
DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" | ||
801 | A | E | b | 0.0 | 7fac_A | AVLYDEGIKPRST |
DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" | ||
802 | L | E | b | 3.4 | 7fac_A | VLCF |
DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" | ||
803 | S | b | 7.8 | 7fac_A | TSDKFYAI |
DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" | |||
804 | P | T | e | 38.0 | 7fac_A | PDNVSGI |
DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" | ||
805 | G | T | e | 69.0 | 7fac_A | GHIAN |
DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" | ||
806 | L | S | e | 20.2 | 7fac_A | VKLGCM |
DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" | ||
807 | L | e | 29.2 | 7fac_A | LVMGTI |
DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" | |||
808 | A | E | b | 0.0 | 7fac_A | VADLNEGIKPRST |
DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" | ||
809 | T | E | b | 0.0 | 7fac_A | LTQSDVP |
DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" | ||
810 | N | E | b | 3.6 | 7fac_A | NCDGKPTAEILQRSV |
DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" | ||
811 | N | E | b | 1.2 | 7fac_A | NTWQKAGLS |
DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" | ||
812 | V | E | b | 4.7 | 7fac_A | LARVIT |
DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" | ||
813 | F | E | b | 2.9 | 7fac_A | FWC |
DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" | ||
814 | R | E | e | 30.0 | 7fac_A | RPLTS |
DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" | ||
815 | L | E | b | 10.7 | 7fac_A | LCV |
DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" | ||
816 | K | T | e | 65.1 | 7fac_A | KAPRD |
DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" | ||
817 | G | T | e | 81.0 | 7fac_A | GCQ |
DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" | ||
818 | G | e | 125.0 | 7fac_A | GADEFIKLNPQRSTVY |
SITE /note="Cleavage; by PL-PRO" DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" SITE /note="Cleavage; by PL-PRO" DOMAIN /note="CoV Nsp2 C-terminal" TOPO_DOM /note="Cytoplasmic" | |||
819 | A | - | - | - | - | AGMFDEIKLNPQRSTVY |
SITE /note="Cleavage; by PL-PRO" TOPO_DOM /note="Cytoplasmic" SITE /note="Cleavage; by PL-PRO" TOPO_DOM /note="Cytoplasmic" | ||
820 | P | - | - | - | - | PLAEGSVDFIKNQRTCHMWY |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
821 | I | - | - | - | - | VSCTPILADEGKRFHMNQY |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
822 | K | - | - | - | - | KRSA |
DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" | ||
823 | G | - | - | - | - | KGCR |
DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" | ||
824 | V | - | - | - | - | V |
DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" | ||
825 | T | - | - | - | - | TEANKV |
DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" | ||
826 | F | - | - | - | - | F |
DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" | ||
827 | G | - | - | - | - | GNK |
DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" | ||
828 | E | - | - | - | - | DEG |
DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" | ||
829 | D | - | - | - | - | DKEQV |
DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" | ||
830 | T | - | - | - | - | TKQNEV |
DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" | ||
831 | V | - | - | - | - | VT |
DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" | ||
832 | W | - | - | - | - | HKVNMRLIW |
DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" | ||
833 | E | - | - | - | - | ETK |
DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" | ||
834 | V | - | - | - | - | IV |
DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" | ||
835 | Q | - | - | - | - | PAQTI |
DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" | ||
836 | G | - | - | - | - | SAGN |
DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" | ||
837 | Y | - | - | - | - | TYVLM |
DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" | ||
838 | K | - | - | - | - | RKVM |
DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" | ||
839 | N | - | - | - | - | STKNI |
DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" | ||
840 | V | - | - | - | - | VI |
DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" | ||
841 | R | - | - | - | - | KSNTR |
DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" | ||
842 | I | - | - | - | - | IVF |
DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" | ||
843 | T | - | - | - | - | TFSEMDIN |
DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" | ||
844 | F | - | - | - | - | YF |
DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" | ||
845 | E | - | - | - | - | DEAN |
DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" | ||
846 | L | - | - | - | - | LIV |
DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" | ||
847 | D | - | - | - | - | DHC |
DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" | ||
848 | E | - | - | - | - | EAPKSNV |
DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" | ||
849 | R | - | - | - | - | VTRDG |
DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" | ||
850 | V | - | - | - | - | FLVI |
DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" | ||
851 | D | - | - | - | - | DN |
DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" | ||
852 | K | - | - | - | - | ATKSD |
DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" | ||
853 | V | - | - | - | - | IVL |
DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" | ||
854 | L | - | - | - | - | L |
DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" | ||
855 | N | - | - | - | - | NSGD |
DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" | ||
856 | E | - | - | - | - | KSET |
DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" | ||
857 | K | - | - | - | - | AKVSE |
DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" | ||
858 | C | - | - | - | - | CLM |
DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" | ||
859 | S | - | - | - | - | SAGR |
DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" | ||
860 | V | - | - | - | - | TVEPA |
DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" | ||
861 | Y | - | - | - | - | FY |
DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" | ||
862 | T | - | - | - | - | ETQV |
DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" | ||
863 | V | - | - | - | - | V |
DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" | ||
864 | E | - | - | - | - | ED |
DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" | ||
865 | S | - | - | - | - | KDSEL |
DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" | ||
866 | G | - | - | - | - | GDTS |
DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" | ||
867 | T | - | - | - | - | VTL |
DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" | ||
868 | E | - | - | - | - | TEDLKSP |
DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" | ||
869 | V | - | - | - | - | VLMI |
DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" | ||
870 | T | - | - | - | - | EDTKN |
DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" | ||
871 | E | - | - | - | - | ED |
DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" | ||
872 | F | - | - | - | - | FL |
DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" | ||
873 | A | - | - | - | - | AVYL |
DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" | ||
874 | C | - | - | - | - | DCA |
DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" | ||
875 | V | - | - | - | - | V |
DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" | ||
876 | V | - | - | - | - | VI |
DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" | ||
877 | A | - | - | - | - | KALIQCV |
DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" | ||
878 | E | - | - | - | - | DEK |
DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" | ||
879 | A | - | - | - | - | AEGQ |
DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" | ||
880 | V | - | - | - | - | VIA |
DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" | ||
881 | V | - | - | - | - | EVILYS |
DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" | ||
882 | K | - | - | - | - | KESTDN |
DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" | ||
883 | T | - | - | - | - | TLAKR |
DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" | ||
884 | L | - | - | - | - | L |
DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" | ||
885 | Q | - | - | - | - | SQTNLADEFGIKPRVY |
DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" | ||
886 | P | - | - | - | - | PKSLADEFGINQRTVY |
DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" | ||
887 | V | - | - | - | - | CVLADEFGIKNPQRSTY |
DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" | ||
888 | S | - | - | - | - | KSLIV |
DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" | ||
889 | D | - | - | - | - | DERK |
DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" | ||
890 | L | - | - | - | - | LVGI |
DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" | ||
891 | L | - | - | - | - | LGYEF |
DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" | ||
892 | T | - | - | - | - | TGADSRNY |
DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" | ||
893 | N | - | - | - | - | DKINGPQV |
DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" | ||
894 | M | - | - | - | - | VMDWRL |
DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" | ||
895 | G | - | - | - | - | GPSCR |
DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" | ||
896 | I | - | - | - | - | IAFE |
DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" | ||
897 | D | - | - | - | - | DFALN |
DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" | ||
898 | L | - | - | - | - | LV |
DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" | ||
899 | D | - | - | - | - | DEQN |
DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" | ||
900 | E | - | - | - | - | DKERAFGILNPQSTV |
DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" | ||
901 | W | - | - | - | - | FLWADEGIKNPQRSTV |
DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" | ||
902 | S | - | - | - | - | IASELNVDFGKPQRT |
DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" | ||
903 | V | - | - | - | - | DVETGMAFIKLNPQRS |
DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" | ||
904 | A | - | - | - | - | ANDVST |
DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" | ||
905 | T | - | - | - | - | PTQYESV |
DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" | ||
906 | F | - | - | - | - | CVELFY |
DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" | ||
907 | Y | - | - | - | - | YFQ |
DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" | ||
908 | L | - | - | - | - | LVC |
DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" | ||
909 | F | - | - | - | - | FYC |
DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" | ||
910 | D | - | - | - | - | DNQS |
DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" | ||
911 | D | - | - | - | - | EQADK |
DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" | ||
912 | A | - | - | - | - | AEDGS |
DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" | ||
913 | G | - | - | - | - | GSY |
DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" | ||
914 | E | - | - | - | - | EDT |
DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" | ||
915 | E | - | - | - | - | ERCKALF |
DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" | ||
916 | N | - | - | - | - | VAKISN |
DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" | ||
917 | F | - | - | - | - | LIWFM |
DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" | ||
918 | S | - | - | - | - | SAM |
DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" | ||
919 | S | - | - | - | - | SPE |
DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" | ||
920 | R | - | - | - | - | KRTNEH |
DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" | ||
921 | M | - | - | - | - | MSL |
DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" | ||
922 | Y | - | - | - | - | YTVI |
DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" | ||
923 | C | - | - | - | - | CFE |
DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" | ||
924 | S | - | - | - | - | SGAT |
DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" | ||
925 | F | - | - | - | - | FLIV |
DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" | ||
926 | Y | - | - | - | - | TNYSVHA |
DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" | ||
927 | P | - | - | - | - | PAGI |
DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" | ||
928 | P | - | - | - | - | PVSDEAL |
DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" | ||
929 | D | - | - | - | - | DCALEFGIKNPQRSTVY |
DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" | ||
930 | E | - | - | - | - | EDVALFGIKNPQRSTY |
DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="Ubiquitin-like 1" TOPO_DOM /note="Cytoplasmic" | ||
931 | E | - | - | - | - | EADVFGIKLNPQRST |
TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
932 | E | - | - | - | - | EMADLFGIKNPQRSTVY |
TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
933 | E | - | - | - | - | EAVDWGLS |
TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
934 | D | - | - | - | - | DECGIVATLS |
TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
935 | D | - | - | - | - | DEQRSGVAL |
TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
936 | A | - | - | - | - | AESDFVLGIKNPQRTY |
TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
937 | E | - | - | - | - | EIDVFCYAGKLNPQRST |
TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
938 | C | - | - | - | - | ECVALDFGIKNPQRST |
TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
939 | E | - | - | - | - | EDVIAFGKLNPQRST |
TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
940 | E | - | - | - | - | EVASDFGIKLNPQRT |
TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
941 | E | - | - | - | - | EDQMSANFGIKLPRTV |
TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
942 | E | - | - | - | - | ETPGDYFQAIKLNRSV |
TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
943 | I | - | - | - | - | IVLSEDT |
TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
944 | D | - | - | - | - | DEVPTCS |
TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
945 | E | - | - | - | - | EDPGS |
TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
946 | T | - | - | - | - | TVDIAQYSHE |
TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
947 | C | - | - | - | - | VDLCTAEGKS |
TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
948 | E | - | - | - | - | EVDSQC |
TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
949 | H | - | - | - | - | EQAHNVDY |
TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
950 | E | - | - | - | - | EGAQSTDFIKLNPRV |
TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
951 | Y | - | - | - | - | IYESHMDGLAFKNPQRTV |
TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
952 | G | - | - | - | - | EDGNLAFIKPQRSTVY |
TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
953 | T | - | - | - | - | TSDLVI |
TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
954 | E | - | - | - | - | EDQSA |
TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
955 | D | - | - | - | - | DEGAIKLPRSTV |
TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
956 | D | - | - | - | - | DVQEAGIKLPRST |
TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
957 | Y | - | - | - | - | EYVWSLADGIKPRTCFHMNQ |
TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
958 | Q | - | - | - | - | VKLEQANTDGIPRSCFHMY |
TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
959 | G | - | - | - | - | GAFDLSEIKNPQRTVCHMY |
TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
960 | L | - | - | - | - | LTFPKADEGINRSVCHMQY |
TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
961 | P | - | - | - | - | PVTALDEGIKNRSCFHMQY |
TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
962 | L | - | - | - | - | LATIDEFGKNPQRSVY |
TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
963 | E | - | - | - | - | EDTSAFGIKLNPQRV |
TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
964 | F | - | - | - | - | FVLDITWAEGKPRSCHMNQY |
TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
965 | G | - | - | - | - | GEATSLDFIKNPQRVY |
TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
966 | A | - | - | - | - | ASVTGL |
TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
967 | S | - | - | - | - | ASEVQGTL |
TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
968 | A | - | - | - | - | KTDLGACVQS |
TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
969 | E | - | - | - | - | EQGSVADPL |
TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
970 | T | - | - | - | - | TAQCERSVIPDGKLN |
TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
971 | V | - | - | - | - | VFAELPCIDGKNQRST |
TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
972 | R | - | - | - | - | EAKQFGLSIYVHRDNPT |
COMPBIAS /note="Acidic residues" REGION /note="Disordered" TOPO_DOM /note="Cytoplasmic" COMPBIAS /note="Acidic residues" REGION /note="Disordered" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
973 | V | - | - | - | - | VPASEITL |
COMPBIAS /note="Acidic residues" REGION /note="Disordered" TOPO_DOM /note="Cytoplasmic" COMPBIAS /note="Acidic residues" REGION /note="Disordered" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
974 | E | - | - | - | - | EADQMVSL |
COMPBIAS /note="Acidic residues" REGION /note="Disordered" TOPO_DOM /note="Cytoplasmic" COMPBIAS /note="Acidic residues" REGION /note="Disordered" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
975 | E | - | - | - | - | EDQYKV |
COMPBIAS /note="Acidic residues" REGION /note="Disordered" TOPO_DOM /note="Cytoplasmic" COMPBIAS /note="Acidic residues" REGION /note="Disordered" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
976 | E | - | - | - | - | EDVQAGST |
COMPBIAS /note="Acidic residues" REGION /note="Disordered" TOPO_DOM /note="Cytoplasmic" COMPBIAS /note="Acidic residues" REGION /note="Disordered" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
977 | E | - | - | - | - | EVQDGAP |
COMPBIAS /note="Acidic residues" REGION /note="Disordered" TOPO_DOM /note="Cytoplasmic" COMPBIAS /note="Acidic residues" REGION /note="Disordered" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
978 | E | - | - | - | - | EQSAK |
COMPBIAS /note="Acidic residues" REGION /note="Disordered" TOPO_DOM /note="Cytoplasmic" COMPBIAS /note="Acidic residues" REGION /note="Disordered" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
979 | E | - | - | - | - | EKSQRALP |
COMPBIAS /note="Acidic residues" REGION /note="Disordered" TOPO_DOM /note="Cytoplasmic" COMPBIAS /note="Acidic residues" REGION /note="Disordered" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
980 | D | - | - | - | - | DENPLAFGIKQRSTVY |
COMPBIAS /note="Acidic residues" REGION /note="Disordered" TOPO_DOM /note="Cytoplasmic" COMPBIAS /note="Acidic residues" REGION /note="Disordered" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
981 | W | - | - | - | - | TVIWESAGLDFHKMNPQRY |
COMPBIAS /note="Acidic residues" REGION /note="Disordered" TOPO_DOM /note="Cytoplasmic" COMPBIAS /note="Acidic residues" REGION /note="Disordered" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
982 | L | - | - | - | - | LVIWCEADGKNPQRST |
COMPBIAS /note="Acidic residues" REGION /note="Disordered" TOPO_DOM /note="Cytoplasmic" COMPBIAS /note="Acidic residues" REGION /note="Disordered" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
983 | D | - | - | - | - | DESLTQV |
COMPBIAS /note="Acidic residues" REGION /note="Disordered" TOPO_DOM /note="Cytoplasmic" COMPBIAS /note="Acidic residues" REGION /note="Disordered" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
984 | D | - | - | - | - | DELNAQSW |
COMPBIAS /note="Acidic residues" REGION /note="Disordered" TOPO_DOM /note="Cytoplasmic" COMPBIAS /note="Acidic residues" REGION /note="Disordered" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
985 | T | - | - | - | - | TESANLQDG |
COMPBIAS /note="Acidic residues" REGION /note="Disordered" TOPO_DOM /note="Cytoplasmic" COMPBIAS /note="Acidic residues" REGION /note="Disordered" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
986 | T | - | - | - | - | IVKLPTSE |
COMPBIAS /note="Acidic residues" REGION /note="Disordered" TOPO_DOM /note="Cytoplasmic" COMPBIAS /note="Acidic residues" REGION /note="Disordered" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
987 | E | - | - | - | - | EDSQCHA |
COMPBIAS /note="Acidic residues" REGION /note="Disordered" TOPO_DOM /note="Cytoplasmic" COMPBIAS /note="Acidic residues" REGION /note="Disordered" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
988 | Q | - | - | - | - | ADETVSQKL |
COMPBIAS /note="Acidic residues" REGION /note="Disordered" TOPO_DOM /note="Cytoplasmic" COMPBIAS /note="Acidic residues" REGION /note="Disordered" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
989 | S | - | - | - | - | GVSIFPTEAKL |
COMPBIAS /note="Acidic residues" REGION /note="Disordered" TOPO_DOM /note="Cytoplasmic" COMPBIAS /note="Acidic residues" REGION /note="Disordered" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
990 | E | - | - | - | - | EQDPATGKLSV |
COMPBIAS /note="Acidic residues" REGION /note="Disordered" TOPO_DOM /note="Cytoplasmic" COMPBIAS /note="Acidic residues" REGION /note="Disordered" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
991 | I | - | - | - | - | VIKADLTCESG |
COMPBIAS /note="Acidic residues" REGION /note="Disordered" TOPO_DOM /note="Cytoplasmic" COMPBIAS /note="Acidic residues" REGION /note="Disordered" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
992 | E | - | - | - | - | EVAPQSKL |
COMPBIAS /note="Acidic residues" REGION /note="Disordered" TOPO_DOM /note="Cytoplasmic" COMPBIAS /note="Acidic residues" REGION /note="Disordered" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
993 | P | - | - | - | - | EPDKTQAGLS |
COMPBIAS /note="Acidic residues" REGION /note="Disordered" TOPO_DOM /note="Cytoplasmic" COMPBIAS /note="Acidic residues" REGION /note="Disordered" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
994 | E | - | - | - | - | EDSQTIPVAKGL |
COMPBIAS /note="Acidic residues" REGION /note="Disordered" TOPO_DOM /note="Cytoplasmic" COMPBIAS /note="Acidic residues" REGION /note="Disordered" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
995 | P | - | - | - | - | QSPEVNMAGLDFIKRTY |
COMPBIAS /note="Acidic residues" REGION /note="Disordered" TOPO_DOM /note="Cytoplasmic" COMPBIAS /note="Acidic residues" REGION /note="Disordered" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
996 | E | - | - | - | - | EDSMLTVAGIKNPQR |
COMPBIAS /note="Acidic residues" REGION /note="Disordered" TOPO_DOM /note="Cytoplasmic" COMPBIAS /note="Acidic residues" REGION /note="Disordered" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
997 | P | - | - | - | - | PDLASTKFEGINRV |
COMPBIAS /note="Acidic residues" REGION /note="Disordered" TOPO_DOM /note="Cytoplasmic" COMPBIAS /note="Acidic residues" REGION /note="Disordered" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
998 | T | - | - | - | - | LTKQIVDSAG |
REGION /note="Disordered" TOPO_DOM /note="Cytoplasmic" REGION /note="Disordered" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
999 | P | - | - | - | - | PVLCNH |
REGION /note="Disordered" TOPO_DOM /note="Cytoplasmic" REGION /note="Disordered" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
1000 | E | - | - | - | - | EDASFKNRTGLV |
REGION /note="Disordered" TOPO_DOM /note="Cytoplasmic" REGION /note="Disordered" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
1001 | E | - | - | - | - | EDKLRIAGSTV |
REGION /note="Disordered" TOPO_DOM /note="Cytoplasmic" REGION /note="Disordered" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
1002 | P | - | - | - | - | PDLKSQEAGTV |
REGION /note="Disordered" TOPO_DOM /note="Cytoplasmic" REGION /note="Disordered" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
1003 | V | - | - | - | - | VILFRYADEGKNPQST |
REGION /note="Disordered" DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" REGION /note="Disordered" DISORDER predicted by DISOPRED DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" | ||
1004 | N | - | - | - | - | NLKAYDQGEFIPRSTV |
DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" | ||
1005 | Q | - | - | - | - | QEPSKAL |
DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" | ||
1006 | F | - | - | - | - | FQLMYK |
DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" | ||
1007 | T | - | - | - | - | ALSTYVC |
DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" | ||
1008 | G | - | - | - | - | GESDNKALV |
DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" | ||
1009 | Y | - | - | - | - | YFVAKLGSDEHIMNPQRT |
DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" | ||
1010 | L | - | - | - | - | LVKGSETADFHIMNPQRY |
DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" | ||
1011 | K | - | - | - | - | KTLSVDCHAEGFIMNPQRY |
DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" | ||
1012 | L | - | - | - | - | ILVMCFADEGKNPQRST |
DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" | ||
1013 | T | - | - | - | - | TVPHNQSYA |
DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" | ||
1014 | D | - | - | - | - | DEPQGN |
DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" | ||
1015 | N | - | - | - | - | NDESGCH |
DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" | ||
1016 | V | - | - | - | - | VFDLA |
DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" | ||
1017 | A | - | - | - | - | ACELYKTF |
DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" | ||
1018 | I | - | - | - | - | FIVLDKQAEGNPRST |
DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" | ||
1019 | K | - | - | - | - | VKPSYHGL |
DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" | ||
1020 | C | - | - | - | - | LKSACVQN |
DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" | ||
1021 | V | - | - | - | - | GAVIFYL |
DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" | ||
1022 | D | - | - | - | - | DCVKEN |
DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" | ||
1023 | I | - | - | - | - | IVFAL |
DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" | ||
1024 | V | - | - | - | - | LIVATDS |
DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" | ||
1025 | K | - | - | - | - | KEQAHRTN |
DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" | ||
1026 | E | - | - | - | - | VAESDILG |
DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" | ||
1027 | A | - | - | - | - | ASELVID |
DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" | ||
1028 | Q | - | - | - | - | QRNDKTALSV |
DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" | ||
1029 | S | - | - | - | - | SVTGLERDCNFHK |
DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" | ||
1030 | A | - | - | - | - | AVLFYR |
DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" | ||
1031 | N | - | - | - | - | NKTDGSFPEHAILRV |
DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" | ||
1032 | P | - | - | - | - | APEVFKHYDGILNQRST |
DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" | ||
1033 | M | - | - | - | - | DAEGFTVCMSIKLNPQR |
DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" | ||
1034 | V | - | - | - | - | VEFCYAIL |
DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" | ||
1035 | I | - | - | - | - | IVL |
DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" | ||
1036 | V | - | - | - | - | VEI |
DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" | ||
1037 | N | - | - | - | - | NS |
DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" | ||
1038 | A | - | - | - | - | APS |
DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" | ||
1039 | A | - | - | - | - | AS |
DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" | ||
1040 | N | - | - | - | - | NS |
DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" | ||
1041 | I | - | - | - | - | ESGIPTVANR |
DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" | ||
1042 | H | - | - | - | - | HSNPDYKQRA |
DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" | ||
1043 | L | - | - | - | - | LMG |
DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" | ||
1044 | K | - | - | - | - | KLHAMQSETIR |
DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" | ||
1045 | H | - | - | - | - | HGEPM |
DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" | ||
1046 | G | - | - | - | - | GDMIVY |
DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" | ||
1047 | G | - | - | - | - | GAS |
DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" | ||
1048 | G | - | - | - | - | GN |
DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" | ||
1049 | V | - | - | - | - | VIAL |
DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" | ||
1050 | A | - | - | - | - | ADC |
DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" | ||
1051 | G | - | - | - | - | GKRLAQY |
DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" | ||
1052 | A | - | - | - | - | AVS |
DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" | ||
1053 | L | - | - | - | - | ILN |
DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" | ||
1054 | N | - | - | - | - | DHAVNSYF |
DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" | ||
1055 | K | - | - | - | - | RKCVDEAI |
DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" | ||
1056 | A | - | - | - | - | AFKMLYST |
DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" | ||
1057 | T | - | - | - | - | ATGCESF |
DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" | ||
1058 | N | - | - | - | - | GKNEL |
DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" | ||
1059 | G | - | - | - | - | PGMFKLSYQN |
DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" | ||
1060 | A | - | - | - | - | AEKPDQIVMSTL |
DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" | ||
1061 | M | - | - | - | - | LIFAMV |
DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" | ||
1062 | Q | - | - | - | - | QLTVIAYS |
DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" | ||
1063 | K | - | - | - | - | EKDAPSNQVRT |
DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" | ||
1064 | E | - | - | - | - | EASLRYWCD |
DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" | ||
1065 | S | - | - | - | - | SCTL |
DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" | ||
1066 | D | - | - | - | - | KDENRAFSTLMQY |
DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" | ||
1067 | D | - | - | - | - | DETQNKRAVHL |
DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" | ||
1068 | Y | - | - | - | - | YVIMLFHW |
DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" | ||
1069 | I | - | - | - | - | VIRSLDAEGKPT |
DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" | ||
1070 | K | - | - | - | - | KQARSGELTV |
DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" | ||
1071 | L | - | - | - | - | KLQARSNEITGV |
DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" | ||
1072 | N | - | - | - | - | NQSHYKGRAEVFL |
DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" | ||
1073 | G | - | - | - | - | GKVQC |
DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" | ||
1074 | P | - | - | - | - | PDEVKSGRCTA |
DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" | ||
1075 | L | - | - | - | - | CLIVTQFR |
DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" | ||
1076 | T | - | - | - | - | PQKATELSGHN |
DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" | ||
1077 | V | - | - | - | - | VPTADEGIKLRS |
DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" | ||
1078 | G | - | - | - | - | GTL |
DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" | ||
1079 | G | - | - | - | - | EDGHNKACRSTLQFIPVY |
DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" | ||
1080 | S | - | - | - | - | ASGCVIKRHDEFLNPQT |
DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" | ||
1081 | C | - | - | - | - | VARYICLKTDEFGNPQS |
DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" | ||
1082 | L | - | - | - | - | ILVMREFKADGPST |
DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" | ||
1083 | L | - | - | - | - | TLSVFIADEGKPR |
DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" | ||
1084 | S | - | - | - | - | KEPSTAGVIQDLR |
DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" | ||
1085 | G | - | - | - | - | GACNSTDEIKLPRV |
DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" | ||
1086 | H | - | - | - | - | GFHDVYNEKPAILQRST |
DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" | ||
1087 | N | - | - | - | - | KNLRSGQVIEDAFPTY |
DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" | ||
1088 | L | - | - | - | - | LEPFKADGINQRSTVY |
DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" | ||
1089 | A | - | - | - | - | AGPCHSVLDEFIKNQRTY |
DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" | ||
1090 | K | - | - | - | - | KHLRIDSNAETFGPQV |
DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" | ||
1091 | K | - | - | - | - | KHYAQSTNFLRDEGIPV |
DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" | ||
1092 | C | - | - | - | - | VICLADEGKPRST |
DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" | ||
1093 | L | - | - | - | - | ILVFADEGKMPRST |
DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" | ||
1094 | H | - | - | - | - | HNDR |
DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" | ||
1095 | V | - | - | - | - | VATI |
DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" | ||
1096 | V | - | - | - | - | VT |
DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" | ||
1097 | G | - | - | - | - | GQ |
DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" | ||
1098 | P | - | - | - | - | PD |
DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" | ||
1099 | N | - | - | - | - | RDNVIKG |
DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" | ||
1100 | L | - | - | - | - | WAYKFHLGTVSNC |
DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" | ||
1101 | N | - | - | - | - | GRNTSHDKQAL |
DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" | ||
1102 | A | - | - | - | - | GKSDAINHLQTEV |
DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" | ||
1103 | G | - | - | - | - | GSHNKVRYDEFQ |
DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" | ||
1104 | E | - | - | - | - | ENQDASVCGRT |
DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" | ||
1105 | D | - | - | - | - | EDAVCLSPHNRTYG |
DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" | ||
1106 | I | - | - | - | - | AVITEYDHPRSFGL |
DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" | ||
1107 | Q | - | - | - | - | EQVKLASNGYR |
DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" | ||
1108 | L | - | - | - | - | LKIQFSTV |
DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" | ||
1109 | L | - | - | - | - | LSVCEAIQTY |
DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" | ||
1110 | K | - | - | - | - | EKASVRDNCHQ |
DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" | ||
1111 | A | - | - | - | - | ADRESKNQVFL |
DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" | ||
1112 | A | - | - | - | - | AVYCIS |
DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" | ||
1113 | Y | - | - | - | - | YHVKNFIWDRT |
DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" | ||
1114 | E | - | - | - | - | KERTQALSFN |
DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" | ||
1115 | N | - | - | - | - | NASHIVEKTGL |
DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" | ||
1116 | F | - | - | - | - | LFTAVIDYSCHMN |
DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" | ||
1117 | N | - | - | - | - | NKHLRAETF |
DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" | ||
1118 | S | - | - | - | - | SKNVEACGQDPIY |
DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" | ||
1119 | Q | - | - | - | - | YKQDHLCERAFGNS |
DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" | ||
1120 | D | - | - | - | - | GDTKESRHANPQ |
DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" | ||
1121 | I | - | - | - | - | LIVSTKCEND |
DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" | ||
1122 | L | - | - | - | - | VIALPKCRGM |
DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" | ||
1123 | L | - | - | - | - | LAVIFM |
DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" | ||
1124 | A | - | - | - | - | TVFAIMKSLEG |
DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" | ||
1125 | P | - | - | - | - | PTS |
DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" | ||
1126 | L | - | - | - | - | LAESVMCIN |
DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" | ||
1127 | L | - | - | - | - | ILV |
DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" | ||
1128 | S | - | - | - | - | SV |
DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" | ||
1129 | A | - | - | - | - | TASVCLDEGIKPR |
DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" | ||
1130 | G | - | - | - | - | GADEIKLPRSTV |
DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" | ||
1131 | I | - | - | - | - | IVADEGKLPRST |
DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" | ||
1132 | F | - | - | - | - | FYADEGIKLPRSTV |
DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" | ||
1133 | G | - | - | - | - | GSKQANDHEILPRTV |
DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" | ||
1134 | A | - | - | - | - | VFYGAIDEKLPRST |
DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" | ||
1135 | K | - | - | - | - | PKDQRETAGLSVCFHIMNY |
DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" | ||
1136 | P | - | - | - | - | PSLKRVTAFIDEGNQ |
DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" | ||
1137 | L | - | - | - | - | ELADKQTIPFGNRSV |
DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" | ||
1138 | Q | - | - | - | - | VKAEQTNRLMSHDFGIP |
DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" | ||
1139 | S | - | - | - | - | ASPHD |
DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" | ||
1140 | L | - | - | - | - | LAFIV |
DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" | ||
1141 | Q | - | - | - | - | EGTQKLDARFNCP |
DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" | ||
1142 | V | - | - | - | - | ITYLVACMSR |
DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" | ||
1143 | C | - | - | - | - | ALCSFM |
DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" | ||
1144 | V | - | - | - | - | VLITDRMSF |
DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" | ||
1145 | Q | - | - | - | - | EDKGRAQINST |
DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" | ||
1146 | T | - | - | - | - | TVRNAICDES |
DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" | ||
1147 | V | - | - | - | - | VIMTACKR |
DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" | ||
1148 | R | - | - | - | - | RDSATKGLPVHNQE |
DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" | ||
1149 | T | - | - | - | - | KTESADCLRVGINPQ |
DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" | ||
1150 | Q | - | - | - | - | TQDNEKRLPAGISV |
DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" | ||
1151 | V | - | - | - | - | VSIAELTCDGKNPR |
DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" | ||
1152 | Y | - | - | - | - | YFERAIVLDGKNPQST |
DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" | ||
1153 | I | - | - | - | - | LVIWFASEKDGNPQRT |
DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" | ||
1154 | A | - | - | - | - | VYATGFLSC |
DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" | ||
1155 | V | - | - | - | - | VCSLIFTY |
DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" | ||
1156 | N | - | - | - | - | NVQTYDRAGSF |
DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" | ||
1157 | D | - | - | - | - | DNEIRGST |
DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" | ||
1158 | K | - | - | - | - | KREQTHY |
DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" | ||
1159 | A | - | - | - | - | ESVAQGDPNKLT |
DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" | ||
1160 | L | - | - | - | - | LMDCVAEFGIKNPQRST |
DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" | ||
1161 | Y | - | - | - | - | YKFLNPMADEGIQRSTV |
DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" | ||
1162 | E | - | - | - | - | EDQSFVKRAGL |
DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" | ||
1163 | Q | - | - | - | - | QESRKLNIHAGV |
DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" | ||
1164 | V | - | - | - | - | LVAIEDGS |
DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" | ||
1165 | V | - | - | - | - | VILSKFHTY |
DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" | ||
1166 | M | - | - | - | - | VIFLQEGAMS |
DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" | ||
1167 | D | - | - | - | - | KVDESIQTG |
DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" | ||
1168 | Y | - | - | - | - | YHNFCGS |
DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" | ||
1169 | L | - | - | - | - | LDFITYM |
DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 1" TOPO_DOM /note="Cytoplasmic" | ||
1170 | D | - | - | - | - | DSVE |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
1171 | N | - | - | - | - | SNQYEGVDML |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
1172 | L | - | - | - | - | ELAFVPK |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
1173 | K | - | - | - | - | KDTRGQSAEILNPV |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
1174 | P | - | - | - | - | PAQEVLDFGIKNRSTY |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
1175 | R | - | - | - | - | TRKQVADEGILNPS |
REGION /note="Disordered" TOPO_DOM /note="Cytoplasmic" REGION /note="Disordered" TOPO_DOM /note="Cytoplasmic" | ||
1176 | V | - | - | - | - | VICLA |
REGION /note="Disordered" TOPO_DOM /note="Cytoplasmic" REGION /note="Disordered" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
1177 | E | - | - | - | - | EKDAYVGILPRST |
REGION /note="Disordered" TOPO_DOM /note="Cytoplasmic" REGION /note="Disordered" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
1178 | A | - | - | - | - | AKNTDQISEGLPRV |
REGION /note="Disordered" TOPO_DOM /note="Cytoplasmic" REGION /note="Disordered" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
1179 | P | - | - | - | - | PFCIVADEGKLNQRST |
REGION /note="Disordered" TOPO_DOM /note="Cytoplasmic" REGION /note="Disordered" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
1180 | K | - | - | - | - | KFDNT |
REGION /note="Disordered" TOPO_DOM /note="Cytoplasmic" REGION /note="Disordered" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
1181 | Q | - | - | - | - | QAKSIVE |
REGION /note="Disordered" TOPO_DOM /note="Cytoplasmic" REGION /note="Disordered" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
1182 | E | - | - | - | - | EKCV |
REGION /note="Disordered" TOPO_DOM /note="Cytoplasmic" REGION /note="Disordered" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
1183 | E | - | - | - | - | TNESVPAK |
REGION /note="Disordered" TOPO_DOM /note="Cytoplasmic" REGION /note="Disordered" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
1184 | P | - | - | - | - | IPKLET |
REGION /note="Disordered" TOPO_DOM /note="Cytoplasmic" REGION /note="Disordered" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
1185 | P | - | - | - | - | PLYFV |
REGION /note="Disordered" TOPO_DOM /note="Cytoplasmic" REGION /note="Disordered" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
1186 | N | - | - | - | - | KLVRDFTN |
REGION /note="Disordered" TOPO_DOM /note="Cytoplasmic" REGION /note="Disordered" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
1187 | T | - | - | - | - | TNVILQA |
REGION /note="Disordered" TOPO_DOM /note="Cytoplasmic" REGION /note="Disordered" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
1188 | E | - | - | - | - | EFT |
REGION /note="Disordered" TOPO_DOM /note="Cytoplasmic" REGION /note="Disordered" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
1189 | D | - | - | - | - | DKEPNY |
REGION /note="Disordered" TOPO_DOM /note="Cytoplasmic" REGION /note="Disordered" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
1190 | S | - | - | - | - | GHNSPVL |
REGION /note="Disordered" TOPO_DOM /note="Cytoplasmic" REGION /note="Disordered" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
1191 | K | - | - | - | - | KIVQEAGLSDFHMNPRTY |
REGION /note="Disordered" TOPO_DOM /note="Cytoplasmic" REGION /note="Disordered" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
1192 | T | - | - | - | - | VNEALTGS |
REGION /note="Disordered" TOPO_DOM /note="Cytoplasmic" REGION /note="Disordered" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
1193 | E | - | - | - | - | KLDHEVAGS |
REGION /note="Disordered" TOPO_DOM /note="Cytoplasmic" REGION /note="Disordered" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
1194 | E | - | - | - | - | EYNVQAGLS |
REGION /note="Disordered" TOPO_DOM /note="Cytoplasmic" REGION /note="Disordered" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
1195 | K | - | - | - | - | RNQKPL |
REGION /note="Disordered" TOPO_DOM /note="Cytoplasmic" REGION /note="Disordered" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
1196 | S | - | - | - | - | SDVPQ |
REGION /note="Disordered" TOPO_DOM /note="Cytoplasmic" REGION /note="Disordered" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
1197 | V | - | - | - | - | VIS |
REGION /note="Disordered" TOPO_DOM /note="Cytoplasmic" REGION /note="Disordered" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
1198 | V | - | - | - | - | VTSEAI |
REGION /note="Disordered" TOPO_DOM /note="Cytoplasmic" REGION /note="Disordered" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
1199 | Q | - | - | - | - | LQSE |
TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
1200 | K | - | - | - | - | KVFR |
TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
1201 | P | - | - | - | - | PFDKT |
TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
1202 | V | - | - | - | - | GVKQI |
TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
1203 | D | - | - | - | - | DTN |
TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
1204 | V | - | - | - | - | VAYFD |
TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
1205 | K | - | - | - | - | KIGE |
TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
1206 | P | - | - | - | - | PAELDFGIKNQRSTVY |
TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
1207 | K | - | - | - | - | KVQRAGLS |
DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" | ||
1208 | I | - | - | - | - | IALF |
DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" | ||
1209 | K | - | - | - | - | KRE |
DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" | ||
1210 | A | - | - | - | - | AG |
DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" | ||
1211 | C | - | - | - | - | CTRAGLSDEFIKNPQVY |
DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" | ||
1212 | I | - | - | - | - | IENVAGLSDFKPQRTY |
DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" | ||
1213 | D | - | - | - | - | DEPAGLSFIKNQRTVY |
DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" | ||
1214 | E | - | - | - | - | ECAGLSDFIKNPQRTVY |
DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" | ||
1215 | V | - | - | - | - | VIGALSDEFKNPQRTY |
DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" | ||
1216 | T | - | - | - | - | LTNAGSDEFIKPQRVY |
DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" | ||
1217 | T | - | - | - | - | TVM |
DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" | ||
1218 | T | - | - | - | - | TNSV |
DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" | ||
1219 | L | - | - | - | - | LAV |
DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" | ||
1220 | E | - | - | - | - | EAIG |
DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" | ||
1221 | E | - | - | - | - | ENKA |
DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" | ||
1222 | T | - | - | - | - | TD |
DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" | ||
1223 | K | - | - | - | - | KH |
DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" | ||
1224 | F | - | - | - | - | LFD |
DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" | ||
1225 | L | - | - | - | - | LVK |
DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" | ||
1226 | T | - | - | - | - | TH |
DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" | ||
1227 | N | - | - | - | - | NGES |
DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" | ||
1228 | K | - | - | - | - | KQSNRAEGLVDFHIMPTY |
DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" | ||
1229 | L | - | - | - | - | LNAEGSVDFHIKMPQRTY |
DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" | ||
1230 | L | - | - | - | - | LPAEGSVDFHIKMNQRTY |
DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" | ||
1231 | L | - | - | - | - | LSDAEGVFHIKMNPQRTY |
DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" | ||
1232 | F | - | - | - | - | FAYEGLSVDHIKMNPQRT |
DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" | ||
1233 | A | - | - | - | - | GAFCIT |
DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" | ||
1234 | D | - | - | - | - | DGS |
DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" | ||
1235 | I | - | - | - | - | IV |
DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" | ||
1236 | N | - | - | - | - | NAGDEFIKLPQRSTV |
DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" | ||
1237 | G | - | - | - | - | GQA |
DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" | ||
1238 | K | - | - | - | - | KAN |
DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" | ||
1239 | L | - | - | - | - | LIVC |
DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" | ||
1240 | Y | - | - | - | - | YLDNH |
DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" | ||
1241 | H | - | - | - | - | NQRAPH |
DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" | ||
1242 | D | - | - | - | - | DA |
DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" | ||
1243 | S | - | - | - | - | SV |
DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" | ||
1244 | Q | - | - | - | - | TKQGA |
DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" | ||
1245 | N | - | - | - | - | GNST |
DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" | ||
1246 | M | - | - | - | - | LMGA |
DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" | ||
1247 | L | - | - | - | - | VLA |
DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" | ||
1248 | R | - | - | - | - | QRLS |
DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" | ||
1249 | G | - | - | - | - | GLAKD |
DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" | ||
1250 | E | - | - | - | - | EI |
DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" | ||
1251 | D | - | - | - | - | DSA |
DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" | ||
1252 | M | - | - | - | - | IDM |
DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" | ||
1253 | S | - | - | - | - | NSDETF |
DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" | ||
1254 | F | - | - | - | - | FYV |
DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" | ||
1255 | L | - | - | - | - | LFVI |
DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" | ||
1256 | E | - | - | - | - | KENL |
DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" | ||
1257 | K | - | - | - | - | KFA |
DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" | ||
1258 | D | - | - | - | - | DSYK |
DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" | ||
1259 | A | - | - | - | - | AGN |
DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" | ||
1260 | P | - | - | - | - | PK |
DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" | ||
1261 | Y | - | - | - | - | YLT |
DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" | ||
1262 | M | - | - | - | - | IVNQM |
DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" | ||
1263 | V | - | - | - | - | VA |
DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" | ||
1264 | G | - | - | - | - | G |
DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" | ||
1265 | D | - | - | - | - | DN |
DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" | ||
1266 | V | - | - | - | - | VCS |
DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" | ||
1267 | I | - | - | - | - | VLI |
DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" | ||
1268 | T | - | - | - | - | TALQS |
DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" | ||
1269 | S | - | - | - | - | SLTQE |
DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" | ||
1270 | G | - | - | - | - | GD |
DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" | ||
1271 | D | - | - | - | - | DSNVLAEFGIKPQRTY |
DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" | ||
1272 | I | - | - | - | - | IL |
DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" | ||
1273 | T | - | - | - | - | TL |
DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" | ||
1274 | C | - | - | - | - | HCMA |
DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" | ||
1275 | V | - | - | - | - | V |
DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" | ||
1276 | V | - | - | - | - | VI |
DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" | ||
1277 | I | - | - | - | - | IGL |
DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" | ||
1278 | P | - | - | - | - | P |
DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" | ||
1279 | S | - | - | - | - | DFAST |
DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" | ||
1280 | K | - | - | - | - | KAD |
DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" | ||
1281 | K | - | - | - | - | KRG |
DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" | ||
1282 | A | - | - | - | - | ADS |
DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" | ||
1283 | G | - | - | - | - | GANK |
DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" | ||
1284 | G | - | - | - | - | GQN |
DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" | ||
1285 | T | - | - | - | - | TDY |
DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" | ||
1286 | T | - | - | - | - | TDIV |
DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" | ||
1287 | E | - | - | - | - | EKQS |
DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" | ||
1288 | M | - | - | - | - | MLN |
DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" | ||
1289 | L | - | - | - | - | LY |
DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" | ||
1290 | S | - | - | - | - | ASK |
DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" | ||
1291 | R | - | - | - | - | RK |
DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" | ||
1292 | A | - | - | - | - | AC |
DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" | ||
1293 | L | - | - | - | - | LVYM |
DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" | ||
1294 | K | - | - | - | - | KVNR |
DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" | ||
1295 | K | - | - | - | - | KAE |
DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" | ||
1296 | V | - | - | - | - | VFY |
DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" | ||
1297 | P | - | - | - | - | PAGLSDEFIKNQRTVY |
DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" | ||
1298 | V | - | - | - | - | VLTIAGSDEFKNPQRY |
DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" | ||
1299 | D | - | - | - | - | NDASGLEFIKPQRTVY |
DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" | ||
1300 | E | - | - | - | - | EKNAGLSDFIPQRTVY |
DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" | ||
1301 | Y | - | - | - | - | YV |
DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" | ||
1302 | I | - | - | - | - | IPV |
DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" | ||
1303 | T | - | - | - | - | TL |
DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" | ||
1304 | T | - | - | - | - | TPV |
DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" | ||
1305 | Y | - | - | - | - | YLV |
DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" | ||
1306 | P | - | - | - | - | PSV |
DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" | ||
1307 | G | - | - | - | - | GPS |
DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" | ||
1308 | Q | - | - | - | - | QAL |
DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" | ||
1309 | G | - | - | - | - | GI |
DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" | ||
1310 | C | - | - | - | - | CISL |
DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" | ||
1311 | A | - | - | - | - | AFN |
DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" | ||
1312 | G | - | - | - | - | G |
DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" | ||
1313 | Y | - | - | - | - | YI |
DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" | ||
1314 | T | - | - | - | - | TFL |
DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" | ||
1315 | L | - | - | - | - | LCIV |
DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" | ||
1316 | E | - | - | - | - | ERV |
DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" | ||
1317 | E | - | - | - | - | E |
DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" | ||
1318 | A | - | - | - | - | AP |
DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" | ||
1319 | K | - | - | - | - | KR |
DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" | ||
1320 | T | - | - | - | - | TV |
DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" | ||
1321 | A | - | - | - | - | ARSV |
DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" | ||
1322 | L | - | - | - | - | LV |
DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" | ||
1323 | K | - | - | - | - | KELR |
DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" | ||
1324 | K | - | - | - | - | KVY |
DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" | ||
1325 | C | - | - | - | - | CLV |
DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" | ||
1326 | K | - | - | - | - | KLV |
DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" | ||
1327 | S | - | - | - | - | SN |
DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" | ||
1328 | A | - | - | - | - | AVS |
DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" | ||
1329 | F | - | - | - | - | FQY |
DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" | ||
1330 | Y | - | - | - | - | YDV |
DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" | ||
1331 | V | - | - | - | - | VI |
DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" | ||
1332 | L | - | - | - | - | LVY |
DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" | ||
1333 | P | - | - | - | - | PKN |
DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" | ||
1334 | S | - | - | - | - | S |
DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" | ||
1335 | E | - | - | - | - | ELIK |
DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 2" TOPO_DOM /note="Cytoplasmic" | ||
1336 | A | - | - | - | - | TAI |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
1337 | P | - | - | - | - | PIS |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
1338 | N | - | - | - | - | NKV |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
1339 | A | - | - | - | - | DEPA |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
1340 | K | - | - | - | - | KIP |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
1341 | E | - | - | - | - | EPTQ |
TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
1342 | E | - | - | - | - | EGQ |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
1343 | I | - | - | - | - | LISV |
DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" | ||
1344 | L | - | - | - | - | LVY |
DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" | ||
1345 | G | - | - | - | - | GDST |
DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" | ||
1346 | T | - | - | - | - | TVFH |
DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" | ||
1347 | V | - | - | - | - | VES |
DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" | ||
1348 | S | - | - | - | - | SGY |
DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" | ||
1349 | W | - | - | - | - | WMD |
DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" | ||
1350 | N | - | - | - | - | NSGLADEFIKPQRTVY |
DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" | ||
1351 | L | - | - | - | - | LFADEGIKNPQRSTVY |
DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" | ||
1352 | R | - | - | - | - | RS |
DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" | ||
1353 | E | - | - | - | - | EGA |
DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" | ||
1354 | M | - | - | - | - | MAI |
DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" | ||
1355 | L | - | - | - | - | LIV |
DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" | ||
1356 | A | - | - | - | - | ARN |
DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" | ||
1357 | H | - | - | - | - | HFKN |
DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" | ||
1358 | A | - | - | - | - | AG |
DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" | ||
1359 | E | - | - | - | - | KE |
DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" | ||
1360 | E | - | - | - | - | EDS |
DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" | ||
1361 | T | - | - | - | - | TKFY |
DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" | ||
1362 | R | - | - | - | - | GR |
DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" | ||
1363 | K | - | - | - | - | KFL |
DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" | ||
1364 | L | - | - | - | - | LT |
DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" | ||
1365 | M | - | - | - | - | MICV |
DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" | ||
1366 | P | - | - | - | - | PFL |
DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" | ||
1367 | I | - | - | - | - | VI |
DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" | ||
1368 | C | - | - | - | - | CV |
DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" | ||
1369 | M | - | - | - | - | TMIVL |
DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" | ||
1370 | D | - | - | - | - | DE |
DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" | ||
1371 | V | - | - | - | - | VYNQT |
DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" | ||
1372 | R | - | - | - | - | SRPK |
DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" | ||
1373 | A | - | - | - | - | A |
DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" | ||
1374 | I | - | - | - | - | INFL |
DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" | ||
1375 | M | - | - | - | - | MLATV |
DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" | ||
1376 | A | - | - | - | - | KAS |
DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" | ||
1377 | T | - | - | - | - | TVL |
DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" | ||
1378 | I | - | - | - | - | LI |
DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" | ||
1379 | Q | - | - | - | - | KQRH |
DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" | ||
1380 | R | - | - | - | - | RGN |
DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" | ||
1381 | K | - | - | - | - | KRAGLDEFINPQSTVY |
DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" | ||
1382 | Y | - | - | - | - | YGTALDEFIKNPQRSV |
DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" | ||
1383 | K | - | - | - | - | KVAGLDEFINPQRSTY |
DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" | ||
1384 | G | - | - | - | - | GDALEFIKNPQRSTVY |
DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" | ||
1385 | I | - | - | - | - | IFLVY |
DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" | ||
1386 | K | - | - | - | - | KTSD |
DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" | ||
1387 | I | - | - | - | - | KIPVT |
DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" | ||
1388 | Q | - | - | - | - | KQT |
DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" | ||
1389 | E | - | - | - | - | EFKT |
DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" | ||
1390 | G | - | - | - | - | GKLQ |
DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" | ||
1391 | I | - | - | - | - | ITLV |
DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" | ||
1392 | V | - | - | - | - | VF |
DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" | ||
1393 | D | - | - | - | - | DS |
DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" | ||
1394 | Y | - | - | - | - | YSLAEGVDFIKNPQRTCHMW |
DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" | ||
1395 | G | - | - | - | - | G |
DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" | ||
1396 | V | - | - | - | - | VYA |
DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" | ||
1397 | R | - | - | - | - | REKQS |
DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" | ||
1398 | F | - | - | - | - | FY |
DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" | ||
1399 | F | - | - | - | - | YF |
DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" | ||
1400 | F | - | - | - | - | FLGC |
DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" | ||
1401 | Y | - | - | - | - | Y |
DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" | ||
1402 | T | - | - | - | - | TS |
DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" | ||
1403 | S | - | - | - | - | SRA |
DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" | ||
1404 | K | - | - | - | - | KDR |
DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" | ||
1405 | E | - | - | - | - | DEKT |
DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" | ||
1406 | P | - | - | - | - | PTA |
DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" | ||
1407 | V | - | - | - | - | LV |
DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" | ||
1408 | A | - | - | - | - | ATHD |
DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" | ||
1409 | S | - | - | - | - | DSE |
DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" | ||
1410 | I | - | - | - | - | IVL |
DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" | ||
1411 | I | - | - | - | - | ISL |
DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" | ||
1412 | T | - | - | - | - | TKAQN |
DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" | ||
1413 | K | - | - | - | - | KADQT |
DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" | ||
1414 | L | - | - | - | - | LA |
DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" | ||
1415 | N | - | - | - | - | N |
DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" | ||
1416 | S | - | - | - | - | SAGKDL |
DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" | ||
1417 | L | - | - | - | - | LCADEFGIKNPQRSTV |
DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" | ||
1418 | N | - | - | - | - | NSGADEFIKLPQRTV |
DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" | ||
1419 | E | - | - | - | - | ERGKV |
DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" | ||
1420 | P | - | - | - | - | PGTADEFIKLNQRSV |
DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" | ||
1421 | L | - | - | - | - | LI |
DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" | ||
1422 | V | - | - | - | - | VIC |
DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" | ||
1423 | T | - | - | - | - | TAMS |
DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" | ||
1424 | M | - | - | - | - | MI |
DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" | ||
1425 | P | - | - | - | - | P |
DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" | ||
1426 | I | - | - | - | - | IFL |
DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" | ||
1427 | G | - | - | - | - | G |
DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" | ||
1428 | Y | - | - | - | - | YF |
DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" | ||
1429 | V | - | - | - | - | VI |
DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" | ||
1430 | T | - | - | - | - | TVS |
DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" | ||
1431 | H | - | - | - | - | HN |
DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" | ||
1432 | G | - | - | - | - | G |
DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" | ||
1433 | F | - | - | - | - | LQF |
DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" | ||
1434 | N | - | - | - | - | DNT |
DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" | ||
1435 | L | - | - | - | - | L |
DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" | ||
1436 | E | - | - | - | - | AEI |
DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" | ||
1437 | E | - | - | - | - | QEV |
DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" | ||
1438 | A | - | - | - | - | AS |
DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" | ||
1439 | A | - | - | - | - | AG |
DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" | ||
1440 | R | - | - | - | - | RVNQS |
DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" | ||
1441 | C | - | - | - | - | CYSQV |
DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" | ||
1442 | M | - | - | - | - | MV |
DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" | ||
1443 | R | - | - | - | - | RK |
DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" | ||
1444 | S | - | - | - | - | SGKQR |
DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" | ||
1445 | L | - | - | - | - | LVI |
DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" | ||
1446 | K | - | - | - | - | KTN |
DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" | ||
1447 | A | - | - | - | - | VA |
DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" | ||
1448 | P | - | - | - | - | P |
DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" | ||
1449 | A | - | - | - | - | YAH |
DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" | ||
1450 | V | - | - | - | - | VTI |
DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" | ||
1451 | V | - | - | - | - | VC |
DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" | ||
1452 | S | - | - | - | - | LSV |
DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" | ||
1453 | V | - | - | - | - | VL |
DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" | ||
1454 | S | - | - | - | - | ASP |
DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" | ||
1455 | S | - | - | - | - | SN |
DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" | ||
1456 | P | - | - | - | - | KPE |
DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" | ||
1457 | D | - | - | - | - | DES |
DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" | ||
1458 | A | - | - | - | - | QAS |
DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" | ||
1459 | V | - | - | - | - | VIADEFGKLNPQRST |
DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" | ||
1460 | T | - | - | - | - | PTADEFGIKLNQRSV |
DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" | ||
1461 | T | - | - | - | - | ILTADEFGKNPQRSV |
DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" | ||
1462 | Y | - | - | - | - | YLMADEFGIKNPQRSTV |
DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" | ||
1463 | N | - | - | - | - | NRE |
DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" | ||
1464 | G | - | - | - | - | GAS |
DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" | ||
1465 | Y | - | - | - | - | YDI |
DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" | ||
1466 | L | - | - | - | - | LVF |
DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" | ||
1467 | T | - | - | - | - | TNMAEGKLSVCDFHIPQRY |
DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" | ||
1468 | S | - | - | - | - | SAEGKLTVCDFHIMNPQRY |
DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" | ||
1469 | S | - | - | - | - | SAGE |
DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" | ||
1470 | S | - | - | - | - | SDIV |
DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Macro 3" TOPO_DOM /note="Cytoplasmic" | ||
1471 | K | - | - | - | - | KQTV |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
1472 | T | - | - | - | - | TN |
DOMAIN /note="DPUP" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="DPUP" TOPO_DOM /note="Cytoplasmic" | ||
1473 | S | - | - | - | - | PSA |
DOMAIN /note="DPUP" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="DPUP" TOPO_DOM /note="Cytoplasmic" | ||
1474 | E | - | - | - | - | EVS |
DOMAIN /note="DPUP" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="DPUP" TOPO_DOM /note="Cytoplasmic" | ||
1475 | E | - | - | - | - | EQTD |
DOMAIN /note="DPUP" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="DPUP" TOPO_DOM /note="Cytoplasmic" | ||
1476 | H | - | - | - | - | DHASY |
DOMAIN /note="DPUP" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="DPUP" TOPO_DOM /note="Cytoplasmic" | ||
1477 | F | - | - | - | - | F |
DOMAIN /note="DPUP" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="DPUP" TOPO_DOM /note="Cytoplasmic" | ||
1478 | V | - | - | - | - | IV |
DOMAIN /note="DPUP" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="DPUP" TOPO_DOM /note="Cytoplasmic" | ||
1479 | E | - | - | - | - | ENVK |
DOMAIN /note="DPUP" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="DPUP" TOPO_DOM /note="Cytoplasmic" | ||
1480 | T | - | - | - | - | TDHN |
DOMAIN /note="DPUP" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="DPUP" TOPO_DOM /note="Cytoplasmic" | ||
1481 | V | - | - | - | - | VIT |
DOMAIN /note="DPUP" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="DPUP" TOPO_DOM /note="Cytoplasmic" | ||
1482 | S | - | - | - | - | SLIRT |
DOMAIN /note="DPUP" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="DPUP" TOPO_DOM /note="Cytoplasmic" | ||
1483 | L | - | - | - | - | LAST |
DOMAIN /note="DPUP" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="DPUP" TOPO_DOM /note="Cytoplasmic" | ||
1484 | A | - | - | - | - | NA |
DOMAIN /note="DPUP" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="DPUP" TOPO_DOM /note="Cytoplasmic" | ||
1485 | G | - | - | - | - | G |
DOMAIN /note="DPUP" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="DPUP" TOPO_DOM /note="Cytoplasmic" | ||
1486 | S | - | - | - | - | GSAM |
DOMAIN /note="DPUP" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="DPUP" TOPO_DOM /note="Cytoplasmic" | ||
1487 | Y | - | - | - | - | YAGLDEFIKNPQRSTV |
DOMAIN /note="DPUP" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="DPUP" TOPO_DOM /note="Cytoplasmic" | ||
1488 | R | - | - | - | - | RHNK |
DOMAIN /note="DPUP" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="DPUP" TOPO_DOM /note="Cytoplasmic" | ||
1489 | D | - | - | - | - | DSC |
DOMAIN /note="DPUP" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="DPUP" TOPO_DOM /note="Cytoplasmic" | ||
1490 | W | - | - | - | - | W |
DOMAIN /note="DPUP" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="DPUP" TOPO_DOM /note="Cytoplasmic" | ||
1491 | S | - | - | - | - | HSD |
DOMAIN /note="DPUP" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="DPUP" TOPO_DOM /note="Cytoplasmic" | ||
1492 | Y | - | - | - | - | LYV |
DOMAIN /note="DPUP" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="DPUP" TOPO_DOM /note="Cytoplasmic" | ||
1493 | S | - | - | - | - | SVTAGLDEFIKNPQRY |
DOMAIN /note="DPUP" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="DPUP" TOPO_DOM /note="Cytoplasmic" | ||
1494 | G | - | - | - | - | GALDEIKNPRSTVCFHMQY |
DOMAIN /note="DPUP" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="DPUP" TOPO_DOM /note="Cytoplasmic" | ||
1495 | Q | - | - | - | - | QLEDAFGIKNPRSTV |
DOMAIN /note="DPUP" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="DPUP" TOPO_DOM /note="Cytoplasmic" | ||
1496 | R | - | - | - | - | RLQES |
DOMAIN /note="DPUP" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="DPUP" TOPO_DOM /note="Cytoplasmic" | ||
1497 | T | - | - | - | - | TIG |
DOMAIN /note="DPUP" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="DPUP" TOPO_DOM /note="Cytoplasmic" | ||
1498 | E | - | - | - | - | EVTQ |
DOMAIN /note="DPUP" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="DPUP" TOPO_DOM /note="Cytoplasmic" | ||
1499 | L | - | - | - | - | LKC |
DOMAIN /note="DPUP" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="DPUP" TOPO_DOM /note="Cytoplasmic" | ||
1500 | G | - | - | - | - | GTDL |
DOMAIN /note="DPUP" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="DPUP" TOPO_DOM /note="Cytoplasmic" | ||
1501 | V | - | - | - | - | VI |
DOMAIN /note="DPUP" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="DPUP" TOPO_DOM /note="Cytoplasmic" | ||
1502 | E | - | - | - | - | EDCQS |
DOMAIN /note="DPUP" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="DPUP" TOPO_DOM /note="Cytoplasmic" | ||
1503 | F | - | - | - | - | FYID |
DOMAIN /note="DPUP" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="DPUP" TOPO_DOM /note="Cytoplasmic" | ||
1504 | L | - | - | - | - | LCK |
DOMAIN /note="DPUP" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="DPUP" TOPO_DOM /note="Cytoplasmic" | ||
1505 | K | - | - | - | - | KNR |
DOMAIN /note="DPUP" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="DPUP" TOPO_DOM /note="Cytoplasmic" | ||
1506 | R | - | - | - | - | RLSW |
DOMAIN /note="DPUP" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="DPUP" TOPO_DOM /note="Cytoplasmic" | ||
1507 | G | - | - | - | - | GNS |
DOMAIN /note="DPUP" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="DPUP" TOPO_DOM /note="Cytoplasmic" | ||
1508 | D | - | - | - | - | DNKQE |
DOMAIN /note="DPUP" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="DPUP" TOPO_DOM /note="Cytoplasmic" | ||
1509 | K | - | - | - | - | KLTQAGDEFINPRSVY |
DOMAIN /note="DPUP" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="DPUP" TOPO_DOM /note="Cytoplasmic" | ||
1510 | I | - | - | - | - | ILTSVAGDEFKNPQRY |
DOMAIN /note="DPUP" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="DPUP" TOPO_DOM /note="Cytoplasmic" | ||
1511 | V | - | - | - | - | VTCI |
DOMAIN /note="DPUP" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="DPUP" TOPO_DOM /note="Cytoplasmic" | ||
1512 | Y | - | - | - | - | YF |
DOMAIN /note="DPUP" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="DPUP" TOPO_DOM /note="Cytoplasmic" | ||
1513 | H | - | - | - | - | YHL |
DOMAIN /note="DPUP" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="DPUP" TOPO_DOM /note="Cytoplasmic" | ||
1514 | T | - | - | - | - | VTC |
DOMAIN /note="DPUP" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="DPUP" TOPO_DOM /note="Cytoplasmic" | ||
1515 | L | - | - | - | - | VFLTADEGKS |
DOMAIN /note="DPUP" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="DPUP" TOPO_DOM /note="Cytoplasmic" | ||
1516 | E | - | - | - | - | KDGES |
DOMAIN /note="DPUP" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="DPUP" TOPO_DOM /note="Cytoplasmic" | ||
1517 | S | - | - | - | - | NSDG |
DOMAIN /note="DPUP" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="DPUP" TOPO_DOM /note="Cytoplasmic" | ||
1518 | P | - | - | - | - | PTDQS |
DOMAIN /note="DPUP" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="DPUP" TOPO_DOM /note="Cytoplasmic" | ||
1519 | V | - | - | - | - | IVTN |
DOMAIN /note="DPUP" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="DPUP" TOPO_DOM /note="Cytoplasmic" | ||
1520 | E | - | - | - | - | ALETKQ |
DOMAIN /note="DPUP" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="DPUP" TOPO_DOM /note="Cytoplasmic" | ||
1521 | F | - | - | - | - | FLY |
DOMAIN /note="DPUP" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="DPUP" TOPO_DOM /note="Cytoplasmic" | ||
1522 | H | - | - | - | - | PHA |
DOMAIN /note="DPUP" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="DPUP" TOPO_DOM /note="Cytoplasmic" | ||
1523 | L | - | - | - | - | FLI |
DOMAIN /note="DPUP" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="DPUP" TOPO_DOM /note="Cytoplasmic" | ||
1524 | D | - | - | - | - | DTES |
DOMAIN /note="DPUP" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="DPUP" TOPO_DOM /note="Cytoplasmic" | ||
1525 | G | - | - | - | - | GLAESVDFIKNPQRTCHMWY |
DOMAIN /note="DPUP" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="DPUP" TOPO_DOM /note="Cytoplasmic" | ||
1526 | E | - | - | - | - | EKDAGLINPRSTVCFHMQY |
DOMAIN /note="DPUP" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="DPUP" TOPO_DOM /note="Cytoplasmic" | ||
1527 | V | - | - | - | - | VAGLDEIKNPRSTCFHMQY |
DOMAIN /note="DPUP" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="DPUP" TOPO_DOM /note="Cytoplasmic" | ||
1528 | L | - | - | - | - | LAVIGDEKNPRSTCFHMQY |
DOMAIN /note="DPUP" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="DPUP" TOPO_DOM /note="Cytoplasmic" | ||
1529 | S | - | - | - | - | STPDL |
DOMAIN /note="DPUP" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="DPUP" TOPO_DOM /note="Cytoplasmic" | ||
1530 | L | - | - | - | - | LVF |
DOMAIN /note="DPUP" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="DPUP" TOPO_DOM /note="Cytoplasmic" | ||
1531 | D | - | - | - | - | SDE |
DOMAIN /note="DPUP" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="DPUP" TOPO_DOM /note="Cytoplasmic" | ||
1532 | K | - | - | - | - | KQAN |
DOMAIN /note="DPUP" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="DPUP" TOPO_DOM /note="Cytoplasmic" | ||
1533 | L | - | - | - | - | CLIA |
DOMAIN /note="DPUP" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="DPUP" TOPO_DOM /note="Cytoplasmic" | ||
1534 | K | - | - | - | - | RK |
DOMAIN /note="DPUP" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="DPUP" TOPO_DOM /note="Cytoplasmic" | ||
1535 | S | - | - | - | - | AST |
DOMAIN /note="DPUP" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="DPUP" TOPO_DOM /note="Cytoplasmic" | ||
1536 | L | - | - | - | - | LY |
DOMAIN /note="DPUP" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="DPUP" TOPO_DOM /note="Cytoplasmic" | ||
1537 | L | - | - | - | - | L |
DOMAIN /note="DPUP" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="DPUP" TOPO_DOM /note="Cytoplasmic" | ||
1538 | S | - | - | - | - | TSAKED |
DOMAIN /note="DPUP" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="DPUP" TOPO_DOM /note="Cytoplasmic" | ||
1539 | L | - | - | - | - | LSATDEFGIKNPQRVY |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
1540 | R | - | - | - | - | RAFKLDEGINPQSTVY |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
1541 | E | e | 61.8 | 4mm3_B | homo | EPATQLDFGIKNRSVY |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
1542 | V | e | 57.3 | 4mm3_B | homo | AVETQLDFGIKNPRSY |
DOMAIN /note="Ubiquitin-like 2" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Ubiquitin-like 2" TOPO_DOM /note="Cytoplasmic" | ||
1543 | K | S | e | 48.1 | 4mm3_B | homo | KNQPR |
DOMAIN /note="Ubiquitin-like 2" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Ubiquitin-like 2" TOPO_DOM /note="Cytoplasmic" | |
1544 | T | e | 48.1 | 4mm3_B | homo | TKNVLPS |
DOMAIN /note="Ubiquitin-like 2" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Ubiquitin-like 2" TOPO_DOM /note="Cytoplasmic" | ||
1545 | I | b | 9.9 | 4mm3_B | homo | IV |
DOMAIN /note="Ubiquitin-like 2" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Ubiquitin-like 2" TOPO_DOM /note="Cytoplasmic" | ||
1546 | K | e | 40.1 | 4mm3_B | homo | DKEPTQV |
DOMAIN /note="Ubiquitin-like 2" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Ubiquitin-like 2" TOPO_DOM /note="Cytoplasmic" | ||
1547 | V | b | 7.3 | 4mm3_B | VI |
DOMAIN /note="Ubiquitin-like 2" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Ubiquitin-like 2" TOPO_DOM /note="Cytoplasmic" | |||
1548 | F | E | e | 24.9 | 4mm3_B | homo | LKFV |
DOMAIN /note="Ubiquitin-like 2" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Ubiquitin-like 2" TOPO_DOM /note="Cytoplasmic" | |
1549 | T | E | b | 18.8 | 4mm3_B | precipitant | VTCL |
DOMAIN /note="Ubiquitin-like 2" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Ubiquitin-like 2" TOPO_DOM /note="Cytoplasmic" | |
1550 | T | E | b | 1.3 | 4mm3_B | T |
DOMAIN /note="Ubiquitin-like 2" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Ubiquitin-like 2" TOPO_DOM /note="Cytoplasmic" | ||
1551 | V | S | b | 5.3 | 4mm3_B | VEIQ |
DOMAIN /note="Ubiquitin-like 2" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Ubiquitin-like 2" TOPO_DOM /note="Cytoplasmic" | ||
1552 | D | S | b | 4.3 | 4mm3_B | D |
DOMAIN /note="Ubiquitin-like 2" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Ubiquitin-like 2" TOPO_DOM /note="Cytoplasmic" | ||
1553 | N | S | e | 42.4 | 4mm3_B | precipitant | GTNQ |
DOMAIN /note="Ubiquitin-like 2" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Ubiquitin-like 2" TOPO_DOM /note="Cytoplasmic" | |
1554 | T | S | e | 37.7 | 4mm3_B | VIRT |
DOMAIN /note="Ubiquitin-like 2" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Ubiquitin-like 2" TOPO_DOM /note="Cytoplasmic" | ||
1555 | N | S | e | 60.6 | 4mm3_B | NS |
DOMAIN /note="Ubiquitin-like 2" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Ubiquitin-like 2" TOPO_DOM /note="Cytoplasmic" | ||
1556 | L | e | 42.1 | 4mm3_B | precipitant | FVLQY |
DOMAIN /note="Ubiquitin-like 2" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Ubiquitin-like 2" TOPO_DOM /note="Cytoplasmic" | ||
1557 | H | E | e | 33.0 | 4mm3_B | precipitant | HKRST |
DOMAIN /note="Ubiquitin-like 2" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Ubiquitin-like 2" TOPO_DOM /note="Cytoplasmic" | |
1558 | T | E | e | 53.9 | 4mm3_B | metal CL precipitant | TDSARN |
DOMAIN /note="Ubiquitin-like 2" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Ubiquitin-like 2" TOPO_DOM /note="Cytoplasmic" | |
1559 | Q | e | 41.3 | 4mm3_B | precipitant | VQCIRH |
DOMAIN /note="Ubiquitin-like 2" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Ubiquitin-like 2" TOPO_DOM /note="Cytoplasmic" | ||
1560 | L | e | 56.7 | 4mm3_B | homo | VLSCIKTEF |
DOMAIN /note="Ubiquitin-like 2" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Ubiquitin-like 2" TOPO_DOM /note="Cytoplasmic" | ||
1561 | V | b | 14.0 | 4mm3_B | VL |
DOMAIN /note="Ubiquitin-like 2" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Ubiquitin-like 2" TOPO_DOM /note="Cytoplasmic" | |||
1562 | D | e | 43.2 | 4mm3_B | ANESDTP |
DOMAIN /note="Ubiquitin-like 2" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Ubiquitin-like 2" TOPO_DOM /note="Cytoplasmic" | |||
1563 | M | S | e | 27.1 | 4mm3_B | homo | TSMENVLD |
DOMAIN /note="Ubiquitin-like 2" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Ubiquitin-like 2" TOPO_DOM /note="Cytoplasmic" | |
1564 | S | S | e | 55.5 | 4mm3_B | SGTDAK |
DOMAIN /note="Ubiquitin-like 2" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Ubiquitin-like 2" TOPO_DOM /note="Cytoplasmic" | ||
1565 | M | e | 24.2 | 4mm3_B | KEQMTAN |
DOMAIN /note="Ubiquitin-like 2" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Ubiquitin-like 2" TOPO_DOM /note="Cytoplasmic" | |||
1566 | T | e | 20.8 | 4mm3_B | precipitant | TSVN |
DOMAIN /note="Ubiquitin-like 2" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Ubiquitin-like 2" TOPO_DOM /note="Cytoplasmic" | ||
1567 | Y | S | b | 10.0 | 4mm3_B | YFL |
DOMAIN /note="Ubiquitin-like 2" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Ubiquitin-like 2" TOPO_DOM /note="Cytoplasmic" | ||
1568 | G | H | e | 21.4 | 4mm3_B | homo precipitant | GRE |
DOMAIN /note="Ubiquitin-like 2" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Ubiquitin-like 2" TOPO_DOM /note="Cytoplasmic" | |
1569 | Q | H | e | 62.8 | 4mm3_B | homo precipitant | QKAESV |
DOMAIN /note="Ubiquitin-like 2" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Ubiquitin-like 2" TOPO_DOM /note="Cytoplasmic" | |
1570 | Q | H | e | 33.7 | 4mm3_B | homo | QTIS |
DOMAIN /note="Ubiquitin-like 2" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Ubiquitin-like 2" TOPO_DOM /note="Cytoplasmic" | |
1571 | F | H | e | 48.3 | 4mm3_B | homo | LFIV |
DOMAIN /note="Ubiquitin-like 2" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Ubiquitin-like 2" TOPO_DOM /note="Cytoplasmic" | |
1572 | G | e | 25.0 | 4mm3_B | homo | G |
DOMAIN /note="Ubiquitin-like 2" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Ubiquitin-like 2" TOPO_DOM /note="Cytoplasmic" | ||
1573 | P | S | e | 47.3 | 4mm3_B | homo | PSTVNQDAC |
DOMAIN /note="Ubiquitin-like 2" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Ubiquitin-like 2" TOPO_DOM /note="Cytoplasmic" | |
1574 | T | E | b | 3.9 | 4mm3_B | VTCI |
DOMAIN /note="Ubiquitin-like 2" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Ubiquitin-like 2" TOPO_DOM /note="Cytoplasmic" | ||
1575 | Y | E | b | 13.9 | 4mm3_B | homo | FYVASL |
DOMAIN /note="Ubiquitin-like 2" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Ubiquitin-like 2" TOPO_DOM /note="Cytoplasmic" | |
1576 | L | E | b | 15.7 | 4mm3_B | CLVYADIFGS |
DOMAIN /note="Ubiquitin-like 2" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Ubiquitin-like 2" TOPO_DOM /note="Cytoplasmic" | ||
1577 | D | T | e | 64.8 | 4mm3_B | DKNE |
DOMAIN /note="Ubiquitin-like 2" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Ubiquitin-like 2" TOPO_DOM /note="Cytoplasmic" | ||
1578 | G | T | b | 0.0 | 4mm3_B | GDN |
DOMAIN /note="Ubiquitin-like 2" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Ubiquitin-like 2" TOPO_DOM /note="Cytoplasmic" | ||
1579 | A | E | e | 36.6 | 4mm3_B | KAVIHTS |
DOMAIN /note="Ubiquitin-like 2" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Ubiquitin-like 2" TOPO_DOM /note="Cytoplasmic" | ||
1580 | D | E | e | 59.3 | 4mm3_B | homo | DNIKV |
DOMAIN /note="Ubiquitin-like 2" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Ubiquitin-like 2" TOPO_DOM /note="Cytoplasmic" | |
1581 | V | G | b | 10.0 | 4mm3_B | VILWAGS |
DOMAIN /note="Ubiquitin-like 2" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Ubiquitin-like 2" TOPO_DOM /note="Cytoplasmic" | ||
1582 | T | G | b | 18.8 | 4mm3_B | homo precipitant | TSFAGL |
DOMAIN /note="Ubiquitin-like 2" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Ubiquitin-like 2" TOPO_DOM /note="Cytoplasmic" | |
1583 | K | G | e | 90.6 | 4mm3_B | homo | KDNTGALS |
DOMAIN /note="Ubiquitin-like 2" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Ubiquitin-like 2" TOPO_DOM /note="Cytoplasmic" | |
1584 | I | e | 52.0 | 4mm3_B | AILTVKQNHGS |
DOMAIN /note="Ubiquitin-like 2" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Ubiquitin-like 2" TOPO_DOM /note="Cytoplasmic" | |||
1585 | K | e | 61.3 | 4mm3_B | KIRDLNVFAGS |
DOMAIN /note="Ubiquitin-like 2" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Ubiquitin-like 2" TOPO_DOM /note="Cytoplasmic" | |||
1586 | P | b | 5.4 | 4mm3_B | PCADEFGIKLNQRSTVY |
DOMAIN /note="Ubiquitin-like 2" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Ubiquitin-like 2" TOPO_DOM /note="Cytoplasmic" | |||
1587 | H | e | 59.2 | 4mm3_B | precipitant | SVHDTMAEFGIKLNPQRY |
DOMAIN /note="Ubiquitin-like 2" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Ubiquitin-like 2" TOPO_DOM /note="Cytoplasmic" | ||
1588 | V | S | e | 74.7 | 4mm3_B | homo | VADEPSINFGKLQRTY |
DOMAIN /note="Ubiquitin-like 2" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Ubiquitin-like 2" TOPO_DOM /note="Cytoplasmic" | |
1589 | N | S | e | 70.3 | 4mm3_B | precipitant | KSNIDLATF |
DOMAIN /note="Ubiquitin-like 2" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Ubiquitin-like 2" TOPO_DOM /note="Cytoplasmic" | |
1590 | H | b | 14.7 | 4mm3_B | precipitant | DHYMFNVQ |
DOMAIN /note="Ubiquitin-like 2" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Ubiquitin-like 2" TOPO_DOM /note="Cytoplasmic" | ||
1591 | E | S | e | 58.3 | 4mm3_B | homo | EKVTGNSA |
DOMAIN /note="Ubiquitin-like 2" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Ubiquitin-like 2" TOPO_DOM /note="Cytoplasmic" | |
1592 | G | S | e | 59.5 | 4mm3_B | homo | GDVS |
DOMAIN /note="Ubiquitin-like 2" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Ubiquitin-like 2" TOPO_DOM /note="Cytoplasmic" | |
1593 | K | e | 42.9 | 4mm3_B | precipitant | KETAVHGLS |
DOMAIN /note="Ubiquitin-like 2" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Ubiquitin-like 2" TOPO_DOM /note="Cytoplasmic" | ||
1594 | T | E | e | 39.6 | 4mm3_B | SKVTELHAIG |
DOMAIN /note="Ubiquitin-like 2" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Ubiquitin-like 2" TOPO_DOM /note="Cytoplasmic" | ||
1595 | F | E | b | 2.4 | 4mm3_B | LFVIAGDEKNPQRSTY |
DOMAIN /note="Ubiquitin-like 2" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Ubiquitin-like 2" TOPO_DOM /note="Cytoplasmic" | ||
1596 | F | E | b | 8.6 | 4mm3_B | precipitant | FYLTVAGDEIKNPQRS |
DOMAIN /note="Ubiquitin-like 2" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Ubiquitin-like 2" TOPO_DOM /note="Cytoplasmic" | |
1597 | V | E | b | 12.0 | 4mm3_B | VLKQFYAGS |
DOMAIN /note="Ubiquitin-like 2" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Ubiquitin-like 2" TOPO_DOM /note="Cytoplasmic" | ||
1598 | L | e | 41.6 | 4mm3_B | homo | LVAYQSIFDEGKNPRT |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
1599 | P | e | 38.0 | 4mm3_B | PEDITASGLFKNQRVY |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | |||
1600 | S | e | 56.2 | 4mm3_B | homo | NATSDGEIKLPQRV |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
1601 | D | S | e | 55.6 | 4mm3_B | precipitant | DTVLAFEGIKNPQRS |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | |
1602 | D | S | e | 76.5 | 4mm3_B | hetero UBB_HUMAN homo | DNSKLE |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | |
1603 | T | S | e | 57.8 | 4mm3_B | homo | TLWASVKNDEGIPQR |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | |
1604 | L | H | b | 11.2 | 4mm3_B | precipitant | LAVSDKTEGINPQR |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | |
1605 | R | H | e | 54.2 | 4mm3_B | hetero UBB_HUMAN homo | EDRLKVAISGNPQT |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | |
1606 | S | H | e | 50.8 | 4mm3_B | hetero UBB_HUMAN homo | SVLKFHAIT |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | |
1607 | E | H | b | 19.6 | 4mm3_B | EDYSTVKAL |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
1608 | A | H | b | 14.3 | 4mm3_B | precipitant | AGKWILDEFNPQRSTVY |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | |
1609 | F | H | e | 34.0 | 4mm3_B | hetero UBB_HUMAN homo precipitant | FVINPWLADEGKRST |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | |
1610 | E | H | e | 60.8 | 4mm3_B | hetero UBB_HUMAN homo precipitant | EGKADQR |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | |
1611 | Y | H | b | 3.9 | 4mm3_B | metal NA precipitant | YSVTFILD |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | |
1612 | Y | H | b | 6.1 | 4mm3_B | YFSDHAL |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | ||
1613 | H | e | 28.8 | 4mm3_B | hetero UBB_HUMAN homo precipitant | GHFYAWDEIKLNPRSTV |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | ||
1614 | T | e | 26.0 | 4mm3_B | precipitant | TGVFPNAL |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | ||
1615 | L | e | 73.0 | 4mm3_B | hetero UBB_HUMAN homo precipitant | LFVADPSTI |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | ||
1616 | D | e | 39.5 | 4mm3_B | hetero ISG15_MOUSE homo precipitant | DNF |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | ||
1617 | E | S | e | 75.9 | 4mm3_B | homo precipitant | EAHQPKSYTV |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | |
1618 | S | T | e | 45.3 | 4mm3_B | homo | SATQPGNK |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | |
1619 | F | H | b | 3.8 | 4mm3_B | FAQKIEDGLNPRSTV |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | ||
1620 | L | H | b | 13.5 | 4mm3_B | LFYEIADGKNPQRSTV |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | ||
1621 | G | H | e | 23.8 | 4mm3_B | homo | GLAVHKQDEFINPRST |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | |
1622 | R | H | e | 27.7 | 4mm3_B | homo | RAEKTIQGLSDFNPVY |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | |
1623 | Y | H | b | 4.8 | 4mm3_B | YAFDEGIKLNPQRSTV |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | ||
1624 | M | H | b | 1.0 | 4mm3_B | precipitant | YMLEADFGIKNPQRSTV |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | |
1625 | S | H | e | 59.4 | 4mm3_B | metal BR precipitant | SFNQHT |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | |
1626 | A | H | b | 4.5 | 4mm3_B | metal BR | AMLTIVF |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | |
1627 | L | H | b | 6.2 | 4mm3_B | precipitant | LSFRVKQ |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | |
1628 | N | H | e | 24.2 | 4mm3_B | precipitant | DNGALSKPVTEFIQRY |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | |
1629 | H | H | e | 42.4 | 4mm3_B | precipitant | HLNMDTAGSEFIKPQRVY |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | |
1630 | T | H | b | 0.0 | 4mm3_B | VTCANDEFGIKLPQRS |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | ||
1631 | K | T | e | 45.8 | 4mm3_B | KQDGHCSAEFILNPRTV |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | ||
1632 | K | T | e | 68.9 | 4mm3_B | precipitant | KAPTQLDEGIRSVCFHMNY |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | |
1633 | W | S | b | 8.0 | 4mm3_B | precipitant | WYFADEGIKLNPQRSTV |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | |
1634 | K | e | 65.1 | 4mm3_B | KPEGTDNQSAFILRV |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | |||
1635 | F | b | 15.8 | 4mm3_B | VFYMADEGIKLNPQRST |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | |||
1636 | P | e | 32.6 | 4mm3_B | VPTQDAEFGIKLNRS |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | |||
1637 | Q | E | e | 55.1 | 4mm3_B | VQYNSFAGL |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | ||
1638 | V | E | b | 7.3 | 4mm3_B | VCHRNI |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | ||
1639 | G | T | e | 26.2 | 4mm3_B | GDNT |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | ||
1640 | G | T | e | 82.1 | 4mm3_B | GNKHP |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | ||
1641 | L | E | b | 5.1 | 4mm3_B | FVYRLNIK |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | ||
1642 | T | E | b | 0.0 | 4mm3_B | RFTVKNL |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | ||
1643 | S | b | 0.0 | 4mm3_B | metal NA | SVAIFLT |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | ||
1644 | I | b | 0.0 | 4mm3_B | LIF |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | |||
1645 | K | e | 56.6 | 4mm3_B | precipitant | KEAGR |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | ||
1646 | W | S | e | 68.9 | 4mm3_B | hetero ISG15_MOUSE UBC_HUMAN ISG15_HUMAN homo precipitant | QTWL |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | |
1647 | A | b | 19.6 | 4mm3_B | STRAN |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | |||
1648 | D | T | e | 47.5 | 4mm3_B | homo precipitant | DNSH |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | |
1649 | N | T | e | 43.0 | 4mm3_B | hetero UBC_HUMAN ISG15_HUMAN ISG15_MOUSE homo precipitant | NGSY |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | |
1650 | N | b | 2.4 | 4mm3_B | hetero UBC_HUMAN ISG15_HUMAN precipitant | N |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | ||
1651 | C | H | b | 11.3 | 4mm3_B | hetero UBC_HUMAN ISG15_HUMAN ISG15_MOUSE precipitant | C |
ACT_SITE /note="For PL-PRO activity" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" ACT_SITE /note="For PL-PRO activity" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | |
1652 | Y | H | b | 2.2 | 4mm3_B | hetero UBC_HUMAN ISG15_HUMAN ISG15_MOUSE | YWF |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | |
1653 | L | H | b | 2.2 | 4mm3_B | VIL |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | ||
1654 | S | H | b | 3.1 | 4mm3_B | metal NA | NSA |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | |
1655 | S | H | b | 0.0 | 4mm3_B | metal NA | AVST |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | |
1656 | V | H | b | 0.0 | 4mm3_B | AVTIS |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | ||
1657 | L | H | b | 0.6 | 4mm3_B | CILM |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | ||
1658 | L | H | b | 0.0 | 4mm3_B | metal NA | LIMVS |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | |
1659 | A | H | b | 0.0 | 4mm3_B | metal NA | MALQTI |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | |
1660 | L | H | b | 0.6 | 4mm3_B | LI |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | ||
1661 | Q | T | b | 7.1 | 4mm3_B | QD |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | ||
1662 | Q | T | b | 15.8 | 4mm3_B | precipitant | HYFQAMRDLS |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | |
1663 | L | S | b | 5.6 | 4mm3_B | precipitant | LAISV |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | |
1664 | E | e | 62.3 | 4mm3_B | precipitant | KDENSR |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | ||
1665 | V | b | 18.0 | 4mm3_B | ILPVAF |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | |||
1666 | K | e | 59.9 | 4mm3_B | metal BR | KRTHS |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | ||
1667 | F | B | b | 1.9 | 4mm3_B | metal BR CL | FW |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | |
1668 | N | S | e | 40.6 | 4mm3_B | hetero UBB_HUMAN precipitant | KNIVPSH |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | |
1669 | A | S | b | 0.0 | 4mm3_B | SKGIPVAFT |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | ||
1670 | P | H | e | 20.2 | 4mm3_B | precipitant | PKWAQVDEGILRST |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | |
1671 | A | H | b | 1.8 | 4mm3_B | metal NA | GAQFW |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | |
1672 | L | H | b | 0.0 | 4mm3_B | LWV |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | ||
1673 | Q | H | e | 48.0 | 4mm3_B | metal BR CL | QKCDNATR |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | |
1674 | E | H | e | 37.7 | 4mm3_B | EARSQVHND |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | ||
1675 | A | H | b | 2.7 | 4mm3_B | metal NA | ALMP |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | |
1676 | Y | H | b | 7.8 | 4mm3_B | WYFG |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | ||
1677 | Y | H | e | 78.7 | 4mm3_B | NYDLEAM |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | ||
1678 | R | H | e | 30.0 | 4mm3_B | precipitant | KERAS |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | |
1679 | A | H | b | 0.0 | 4mm3_B | FLYAH |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | ||
1680 | R | T | e | 45.8 | 4mm3_B | RKLVC |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | ||
1681 | A | T | e | 73.2 | 4mm3_B | GTASL |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | ||
1682 | G | T | e | 32.1 | 4mm3_B | GR |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | ||
1683 | D | e | 43.2 | 4mm3_B | DKRNE |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | |||
1684 | A | b | 0.0 | 4mm3_B | PVAST |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | |||
1685 | A | H | b | 8.0 | 4mm3_B | ATLEGYH |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | ||
1686 | N | H | b | 15.8 | 4mm3_B | precipitant | DRPMNGIE |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | |
1687 | F | H | b | 0.0 | 4mm3_B | FML |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | ||
1688 | C | H | b | 1.3 | 4mm3_B | VCIAL |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | ||
1689 | A | H | b | 0.0 | 4mm3_B | ASHE |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | ||
1690 | L | H | b | 1.7 | 4mm3_B | LWFMV |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | ||
1691 | I | H | b | 1.8 | 4mm3_B | ILVC |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | ||
1692 | L | H | b | 1.1 | 4mm3_B | YLMI |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | ||
1693 | A | H | b | 1.8 | 4mm3_B | AWHFY |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | ||
1694 | Y | H | b | 7.4 | 4mm3_B | hetero ISG15_MOUSE homo precipitant | YIKLSV |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | |
1695 | S | T | b | 8.6 | 4mm3_B | GTSCA |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | ||
1696 | N | T | e | 62.4 | 4mm3_B | hetero ISG15_MOUSE homo | GNDSKMRTH |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | |
1697 | K | e | 22.2 | 4mm3_B | hetero ISG15_MOUSE homo precipitant | FACLVKSR |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | ||
1698 | T | e | 57.8 | 4mm3_B | metal BR homo | TKDEMS |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | ||
1699 | V | T | b | 18.7 | 4mm3_B | metal BR | KFVPY |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | |
1700 | G | T | e | 38.1 | 4mm3_B | homo | GDN |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | |
1701 | E | e | 37.2 | 4mm3_B | hetero ISG15_MOUSE homo precipitant | EDQVAN |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | ||
1702 | L | e | 43.8 | 4mm3_B | hetero UBC_HUMAN ISG15_HUMAN ISG15_MOUSE compound TTT GRM P85 S88 homo precipitant | PKLFS |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | ||
1703 | G | e | 22.6 | 4mm3_B | hetero UBC_HUMAN ISG15_HUMAN ISG15_MOUSE compound TTT GRM P85 S88 precipitant | SGDA |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | ||
1704 | D | e | 32.7 | 4mm3_B | hetero UBC_HUMAN ISG15_HUMAN ISG15_MOUSE compound TTT GRM P85 S88 precipitant | D |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | ||
1705 | V | H | b | 0.0 | 4mm3_B | ASVE |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | ||
1706 | R | H | e | 32.4 | 4mm3_B | hetero UBC_HUMAN ISG15_HUMAN ISG15_MOUSE homo precipitant | ERTNSHAI |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | |
1707 | E | H | e | 52.3 | 4mm3_B | hetero UBC_HUMAN ISG15_HUMAN ISG15_MOUSE homo precipitant | DENRWLMK |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | |
1708 | T | H | b | 2.6 | 4mm3_B | TLFAV |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | ||
1709 | M | H | b | 0.5 | 4mm3_B | LMI |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | ||
1710 | T | H | e | 25.3 | 4mm3_B | hetero ISG15_MOUSE UBC_HUMAN precipitant | HRSTNA |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | |
1711 | H | H | e | 31.4 | 4mm3_B | hetero ISG15_MOUSE homo | KVTNHAIMY |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | |
1712 | L | H | b | 0.0 | 4mm3_B | LVIE |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | ||
1713 | L | H | b | 3.4 | 4mm3_B | LSAFV |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | ||
1714 | Q | T | e | 60.7 | 4mm3_B | hetero ISG15_MOUSE homo precipitant | KERQASDN |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | |
1715 | H | T | b | 19.4 | 4mm3_B | precipitant | HYKEQLF |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | |
1716 | A | B | b | 6.2 | 4mm3_B | AFGMLVS |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | ||
1717 | N | e | 29.7 | 4mm3_B | hetero UBB_HUMAN precipitant | DNESTGKAL |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | ||
1718 | L | b | 7.3 | 4mm3_B | LSAEPV |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | |||
1719 | E | T | e | 77.9 | 4mm3_B | hetero UBB_HUMAN homo | DSTEAIQVCGL |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | |
1720 | S | T | e | 76.6 | 4mm3_B | SGTYQ |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | ||
1721 | A | b | 2.7 | 4mm3_B | precipitant | ATDISVC |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | ||
1722 | K | E | e | 32.5 | 4mm3_B | KVRNTIEQS |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | ||
1723 | R | E | b | 0.8 | 4mm3_B | metal NA homo | RCMATEIL |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | |
1724 | V | E | b | 7.3 | 4mm3_B | VEDMFLN |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | ||
1725 | L | E | b | 4.5 | 4mm3_B | homo precipitant | LTWFHM |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | |
1726 | N | E | b | 7.9 | 4mm3_B | REHNKLQY |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | ||
1727 | V | E | b | 14.0 | 4mm3_B | homo | EVTFADSCQIL |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | |
1728 | V | E | e | 31.3 | 4mm3_B | VWASIGQT |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | ||
1729 | C | E | b | 4.7 | 4mm3_B | metal ZN | CSY |
BINDING /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_label="4" ZN_FING /note="C4-type" ECO:0000269|PubMed:16306590" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" BINDING /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_label="4" ZN_FING /note="C4-type" ECO:0000269|PubMed:16306590" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | |
1730 | K | T | e | 92.9 | 4mm3_B | KDTNESVCAGILPQR |
ZN_FING /note="C4-type" ECO:0000269|PubMed:16306590" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" ZN_FING /note="C4-type" ECO:0000269|PubMed:16306590" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | ||
1731 | H | T | e | 69.6 | 4mm3_B | TVHNEKCLADFGIPQRSY |
ZN_FING /note="C4-type" ECO:0000269|PubMed:16306590" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" ZN_FING /note="C4-type" ECO:0000269|PubMed:16306590" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | ||
1732 | C | T | e | 40.0 | 4mm3_B | metal ZN | C |
BINDING /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_label="4" ZN_FING /note="C4-type" ECO:0000269|PubMed:16306590" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" BINDING /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_label="4" ZN_FING /note="C4-type" ECO:0000269|PubMed:16306590" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | |
1733 | G | E | e | 41.7 | 4mm3_B | GDAS |
ZN_FING /note="C4-type" ECO:0000269|PubMed:16306590" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" ZN_FING /note="C4-type" ECO:0000269|PubMed:16306590" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | ||
1734 | Q | E | e | 44.4 | 4mm3_B | VIQAGKLS |
ZN_FING /note="C4-type" ECO:0000269|PubMed:16306590" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" ZN_FING /note="C4-type" ECO:0000269|PubMed:16306590" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | ||
1735 | K | E | e | 69.8 | 4mm3_B | homo | KRQCST |
ZN_FING /note="C4-type" ECO:0000269|PubMed:16306590" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" ZN_FING /note="C4-type" ECO:0000269|PubMed:16306590" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | |
1736 | T | E | e | 54.5 | 4mm3_B | QDKVSCT |
ZN_FING /note="C4-type" ECO:0000269|PubMed:16306590" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" ZN_FING /note="C4-type" ECO:0000269|PubMed:16306590" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | ||
1737 | T | E | e | 50.6 | 4mm3_B | homo precipitant | ETSVYMNI |
ZN_FING /note="C4-type" ECO:0000269|PubMed:16306590" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" ZN_FING /note="C4-type" ECO:0000269|PubMed:16306590" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | |
1738 | T | E | e | 49.4 | 4mm3_B | homo | TEQSV |
ZN_FING /note="C4-type" ECO:0000269|PubMed:16306590" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" ZN_FING /note="C4-type" ECO:0000269|PubMed:16306590" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | |
1739 | L | E | e | 23.6 | 4mm3_B | hetero UBC_HUMAN homo | LRFVATY |
ZN_FING /note="C4-type" ECO:0000269|PubMed:16306590" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" ZN_FING /note="C4-type" ECO:0000269|PubMed:16306590" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | |
1740 | T | E | e | 59.1 | 4mm3_B | homo | TKVRAPQL |
ZN_FING /note="C4-type" ECO:0000269|PubMed:16306590" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" ZN_FING /note="C4-type" ECO:0000269|PubMed:16306590" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | |
1741 | G | G | e | 22.6 | 4mm3_B | homo | GESVAL |
ZN_FING /note="C4-type" ECO:0000269|PubMed:16306590" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" ZN_FING /note="C4-type" ECO:0000269|PubMed:16306590" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | |
1742 | V | G | b | 12.7 | 4mm3_B | precipitant | VLIPTMA |
ZN_FING /note="C4-type" ECO:0000269|PubMed:16306590" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" ZN_FING /note="C4-type" ECO:0000269|PubMed:16306590" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | |
1743 | E | G | e | 65.8 | 4mm3_B | hetero UBC_HUMAN ISG15_HUMAN ISG15_MOUSE homo | DKENVR |
ZN_FING /note="C4-type" ECO:0000269|PubMed:16306590" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" ZN_FING /note="C4-type" ECO:0000269|PubMed:16306590" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | |
1744 | A | G | b | 0.0 | 4mm3_B | ASVR |
ZN_FING /note="C4-type" ECO:0000269|PubMed:16306590" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" ZN_FING /note="C4-type" ECO:0000269|PubMed:16306590" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | ||
1745 | V | T | b | 0.0 | 4mm3_B | metal NA | VACIS |
ZN_FING /note="C4-type" ECO:0000269|PubMed:16306590" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" ZN_FING /note="C4-type" ECO:0000269|PubMed:16306590" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | |
1746 | M | E | b | 13.5 | 4mm3_B | metal NA homo precipitant | MIVQATC |
ZN_FING /note="C4-type" ECO:0000269|PubMed:16306590" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" ZN_FING /note="C4-type" ECO:0000269|PubMed:16306590" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | |
1747 | Y | E | b | 16.5 | 4mm3_B | hetero UBC_HUMAN metal NA homo precipitant | YHPVFSAL |
ZN_FING /note="C4-type" ECO:0000269|PubMed:16306590" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" ZN_FING /note="C4-type" ECO:0000269|PubMed:16306590" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | |
1748 | M | E | e | 40.6 | 4mm3_B | hetero UBC_HUMAN ISG15_HUMAN ISG15_MOUSE compound GRM homo precipitant | VFCMLTYA |
ZN_FING /note="C4-type" ECO:0000269|PubMed:16306590" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" ZN_FING /note="C4-type" ECO:0000269|PubMed:16306590" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | |
1749 | G | S | e | 63.1 | 4mm3_B | compound GRM | GARPDEFIKLNQSTV |
ZN_FING /note="C4-type" ECO:0000269|PubMed:16306590" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" ZN_FING /note="C4-type" ECO:0000269|PubMed:16306590" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | |
1750 | T | b | 12.3 | 4mm3_B | precipitant | TSVAMDEFGIKLNPQR |
ZN_FING /note="C4-type" ECO:0000269|PubMed:16306590" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" ZN_FING /note="C4-type" ECO:0000269|PubMed:16306590" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | ||
1751 | L | S | b | 6.7 | 4mm3_B | precipitant | LVNPQTADEFGIKRS |
ZN_FING /note="C4-type" ECO:0000269|PubMed:16306590" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" ZN_FING /note="C4-type" ECO:0000269|PubMed:16306590" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | |
1752 | S | b | 11.7 | 4mm3_B | SNDKVTAGLEFIPQRY |
ZN_FING /note="C4-type" ECO:0000269|PubMed:16306590" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" ZN_FING /note="C4-type" ECO:0000269|PubMed:16306590" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | |||
1753 | Y | H | b | 3.0 | 4mm3_B | LKRYAVMGSDEFINPQT |
ZN_FING /note="C4-type" ECO:0000269|PubMed:16306590" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" ZN_FING /note="C4-type" ECO:0000269|PubMed:16306590" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | ||
1754 | D | H | e | 64.2 | 4mm3_B | DELSGTAFIKNPQRVY |
ZN_FING /note="C4-type" ECO:0000269|PubMed:16306590" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" ZN_FING /note="C4-type" ECO:0000269|PubMed:16306590" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | ||
1755 | N | H | e | 49.7 | 4mm3_B | precipitant | DEGHVNQALSFIKPRTY |
ZN_FING /note="C4-type" ECO:0000269|PubMed:16306590" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" ZN_FING /note="C4-type" ECO:0000269|PubMed:16306590" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | |
1756 | L | H | b | 0.0 | 4mm3_B | LFV |
ZN_FING /note="C4-type" ECO:0000269|PubMed:16306590" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" ZN_FING /note="C4-type" ECO:0000269|PubMed:16306590" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | ||
1757 | K | H | b | 17.9 | 4mm3_B | metal NA | KVQYHREFA |
ZN_FING /note="C4-type" ECO:0000269|PubMed:16306590" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" ZN_FING /note="C4-type" ECO:0000269|PubMed:16306590" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | |
1758 | T | H | e | 72.1 | 4mm3_B | TAVKCDLSINRM |
ZN_FING /note="C4-type" ECO:0000269|PubMed:16306590" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" ZN_FING /note="C4-type" ECO:0000269|PubMed:16306590" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | ||
1759 | G | e | 27.4 | 4mm3_B | GQPRTV |
ZN_FING /note="C4-type" ECO:0000269|PubMed:16306590" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" ZN_FING /note="C4-type" ECO:0000269|PubMed:16306590" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | |||
1760 | V | E | b | 14.0 | 4mm3_B | YVTCLFHM |
ZN_FING /note="C4-type" ECO:0000269|PubMed:16306590" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" ZN_FING /note="C4-type" ECO:0000269|PubMed:16306590" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | ||
1761 | S | E | e | 67.2 | 4mm3_B | SDTENKQAGL |
ZN_FING /note="C4-type" ECO:0000269|PubMed:16306590" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" ZN_FING /note="C4-type" ECO:0000269|PubMed:16306590" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | ||
1762 | I | E | e | 26.3 | 4mm3_B | hetero UBC_HUMAN homo | IVEDNYAGLS |
ZN_FING /note="C4-type" ECO:0000269|PubMed:16306590" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" ZN_FING /note="C4-type" ECO:0000269|PubMed:16306590" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | |
1763 | P | E | e | 86.0 | 4mm3_B | hetero UBC_HUMAN ISG15_HUMAN ISG15_MOUSE homo | GCPVAITDLS |
ZN_FING /note="C4-type" ECO:0000269|PubMed:16306590" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" ZN_FING /note="C4-type" ECO:0000269|PubMed:16306590" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | |
1764 | C | b | 16.7 | 4mm3_B | metal ZN homo | CPF |
BINDING /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_label="4" ZN_FING /note="C4-type" ECO:0000269|PubMed:16306590" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" BINDING /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_label="4" ZN_FING /note="C4-type" ECO:0000269|PubMed:16306590" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | ||
1765 | V | T | e | 102.7 | 4mm3_B | hetero UBC_HUMAN ISG15_HUMAN homo | VTQCPNSI |
ZN_FING /note="C4-type" ECO:0000269|PubMed:16306590" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" ZN_FING /note="C4-type" ECO:0000269|PubMed:16306590" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | |
1766 | C | T | e | 36.0 | 4mm3_B | metal ZN homo | CHP |
BINDING /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_label="4" ZN_FING /note="C4-type" ECO:0000269|PubMed:16306590" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" BINDING /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_label="4" ZN_FING /note="C4-type" ECO:0000269|PubMed:16306590" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | |
1767 | G | S | e | 84.5 | 4mm3_B | metal ZN | GH |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | |
1768 | R | S | e | 45.1 | 4mm3_B | RLASIKVGDN |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | ||
1769 | D | E | e | 73.5 | 4mm3_B | KHNPDVESQ |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | ||
1770 | A | E | b | 1.8 | 4mm3_B | ALKYRVSN |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | ||
1771 | T | E | e | 41.6 | 4mm3_B | ITVLHNYK |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | ||
1772 | Q | E | b | 11.7 | 4mm3_B | hetero UBC_HUMAN homo precipitant | RDVKQSAEGILPT |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | |
1773 | Y | E | b | 3.9 | 4mm3_B | YHQREKSV |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | ||
1774 | L | E | b | 0.0 | 4mm3_B | metal NA | VLCRI |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | |
1775 | V | E | b | 15.3 | 4mm3_B | VTIRS |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | ||
1776 | Q | E | e | 23.0 | 4mm3_B | EQSKVR |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | ||
1777 | Q | E | b | 0.0 | 4mm3_B | QFHVAILK |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | ||
1778 | E | E | e | 37.2 | 4mm3_B | NSREGKVTD |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | ||
1779 | S | S | b | 11.7 | 4mm3_B | precipitant | GSVTALN |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | |
1780 | S | S | e | 20.3 | 4mm3_B | precipitant | PTSGR |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | |
1781 | F | E | b | 1.0 | 4mm3_B | precipitant | FWVYAIR |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | |
1782 | V | E | b | 0.0 | 4mm3_B | metal NA | LVIA |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | |
1783 | M | E | b | 0.0 | 4mm3_B | metal NA precipitant | ILVM |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | |
1784 | M | E | b | 0.0 | 4mm3_B | metal NA | LMCTVIN |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | |
1785 | S | E | b | 0.0 | 4mm3_B | precipitant | SFNTV |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | |
1786 | A | E | b | 8.9 | 4mm3_B | GNAVC |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | ||
1787 | P | E | e | 65.1 | 4mm3_B | hetero UBC_HUMAN compound GRM TTT P85 S88 homo | PTKLV |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | |
1788 | P | E | e | 46.5 | 4mm3_B | hetero ISG15_HUMAN UBC_HUMAN ISG15_MOUSE compound TTT GRM P85 S88 precipitant | PGCVNL |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | |
1789 | A | E | e | 45.5 | 4mm3_B | AEVNTKLS |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | ||
1790 | E | E | e | 64.3 | 4mm3_B | homo | EGQPSAL |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | |
1791 | Y | E | e | 28.3 | 4mm3_B | metal NH4 precipitant | VKYISDRAGL |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | |
1792 | K | E | e | 50.5 | 4mm3_B | precipitant | KVIPRLDET |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | |
1793 | L | E | b | 1.1 | 4mm3_B | precipitant | LAVISM |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | |
1794 | Q | E | e | 42.3 | 4mm3_B | precipitant | PQTDLSK |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | |
1795 | Q | T | e | 46.4 | 4mm3_B | SDPQTAEKH |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | ||
1796 | G | T | e | 94.0 | 4mm3_B | GSDTHN |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | ||
1797 | T | S | e | 55.2 | 4mm3_B | precipitant | VTLGIKAS |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | |
1798 | F | b | 9.1 | 4mm3_B | metal BR CL | FLYAWGQDEIKNPRSTV |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | ||
1799 | L | S | e | 22.5 | 4mm3_B | metal BR CL precipitant | LVIKYRST |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | |
1800 | C | E | b | 0.0 | 4mm3_B | ACTKNDS |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | ||
1801 | A | E | b | 0.0 | 4mm3_B | metal NA | AGFELSV |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | |
1802 | N | E | b | 0.0 | 4mm3_B | metal NA | NIVPSADEFGKLQRTY |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | |
1803 | E | E | b | 0.5 | 4mm3_B | homo | VIESADMFGKLNPQRTY |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | |
1804 | Y | E | e | 23.0 | 4mm3_B | hetero UBC_HUMAN ISG15_HUMAN ISG15_MOUSE compound TTT P85 S88 precipitant | YF |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | |
1805 | T | E | e | 48.7 | 4mm3_B | homo | TQRSKM |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | |
1806 | G | E | e | 60.7 | 4mm3_B | homo | GSA |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | |
1807 | N | e | 48.5 | 4mm3_B | compound P85 homo precipitant | NEPSGLTD |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | ||
1808 | Y | S | e | 94.3 | 4mm3_B | hetero ISG15_HUMAN ISG15_MOUSE UBC_HUMAN compound GRM TTT P85 S88 homo precipitant | TVYFGNADEIKLPQRS |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | |
1809 | Q | S | e | 71.9 | 4mm3_B | hetero UBC_HUMAN ISG15_HUMAN ISG15_MOUSE compound TTT GRM P85 S88 homo | SDQGTVAK |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | |
1810 | C | e | 38.7 | 4mm3_B | hetero UBC_HUMAN ISG15_HUMAN ISG15_MOUSE homo | VCAKNRL |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | ||
1811 | G | E | e | 27.4 | 4mm3_B | hetero UBC_HUMAN ISG15_HUMAN ISG15_MOUSE precipitant | G |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | |
1812 | H | E | e | 22.5 | 4mm3_B | hetero ISG15_HUMAN ISG15_MOUSE UBC_HUMAN homo precipitant | H |
ACT_SITE /note="For PL-PRO activity" ECO:0000269|PubMed:16306590" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" ACT_SITE /note="For PL-PRO activity" ECO:0000269|PubMed:16306590" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | |
1813 | Y | E | b | 4.3 | 4mm3_B | hetero UBC_HUMAN ISG15_HUMAN ISG15_MOUSE compound TTT GRM P85 S88 precipitant | Y |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | |
1814 | T | E | b | 1.9 | 4mm3_B | TVMLK |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | ||
1815 | H | E | b | 0.0 | 4mm3_B | metal NA | HYVAGLS |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | |
1816 | I | E | b | 0.0 | 4mm3_B | VIDAFYL |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | ||
1817 | T | E | b | 0.0 | 4mm3_B | TKRDAVF |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | ||
1818 | A | E | e | 21.4 | 4mm3_B | ACNVHDLS |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | ||
1819 | K | S | e | 42.0 | 4mm3_B | KGNRE |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | ||
1820 | E | S | e | 64.8 | 4mm3_B | ENTDPKGQS |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | ||
1821 | T | S | b | 18.8 | 4mm3_B | GATSKLNP |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | ||
1822 | L | E | b | 0.0 | 4mm3_B | LYMIVK |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | ||
1823 | Y | E | b | 7.8 | 4mm3_B | YQLSV |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | ||
1824 | R | E | e | 26.5 | 4mm3_B | homo | KLHRVMCADEFGINPQSTY |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | |
1825 | I | E | b | 0.6 | 4mm3_B | metal NA | YFIVAEGKLSTCDHMNPQR |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | |
1826 | D | E | e | 24.7 | 4mm3_B | metal NA homo | D |
ACT_SITE /note="For PL-PRO activity" ECO:0000269|PubMed:16306590" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" ACT_SITE /note="For PL-PRO activity" ECO:0000269|PubMed:16306590" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | |
1827 | G | T | b | 6.0 | 4mm3_B | metal NA | GAS |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | |
1828 | A | T | e | 39.3 | 4mm3_B | precipitant | DAGCNS |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | |
1829 | H | E | e | 67.5 | 4mm3_B | precipitant | RNSTAHVLY |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | |
1830 | L | E | e | 39.3 | 4mm3_B | precipitant | LVFR |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | |
1831 | T | E | e | 49.4 | 4mm3_B | precipitant | TKSVRN |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | |
1832 | K | E | e | 52.8 | 4mm3_B | precipitant | KPR |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | |
1833 | M | E | e | 25.6 | 4mm3_B | TVMGHCYS |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | ||
1834 | S | S | e | 71.9 | 4mm3_B | SDT |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | ||
1835 | E | E | e | 68.3 | 4mm3_B | DELG |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | ||
1836 | Y | E | b | 10.4 | 4mm3_B | NYAMVLSW |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | ||
1837 | K | E | e | 66.5 | 4mm3_B | KVLST |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | ||
1838 | G | E | b | 6.0 | 4mm3_B | GLCS |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | ||
1839 | P | E | b | 14.7 | 4mm3_B | homo | PKNSC |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | |
1840 | V | E | b | 0.0 | 4mm3_B | VFMLAI |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | ||
1841 | T | E | b | 8.4 | 4mm3_B | hetero UBC_HUMAN ISG15_HUMAN ISG15_MOUSE compound TTT GRM P85 S88 precipitant | TS |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | |
1842 | D | E | b | 1.9 | 4mm3_B | DSN |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | ||
1843 | V | E | b | 0.0 | 4mm3_B | VCI |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | ||
1844 | F | E | b | 0.0 | 4mm3_B | LVFWY |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | ||
1845 | Y | E | b | 7.8 | 4mm3_B | metal BR CL NH4 precipitant | YVF |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | |
1846 | K | E | e | 47.6 | 4mm3_B | metal BR CL precipitant | KPSVGL |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | |
1847 | E | b | 9.0 | 4mm3_B | ENKAPGT |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | |||
1848 | T | S | e | 72.1 | 4mm3_B | QTLPVNIAG |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | ||
1849 | S | E | e | 51.6 | 4mm3_B | SKTRVN |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | ||
1850 | Y | E | b | 19.1 | 4mm3_B | metal NA | YQANFL |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | |
1851 | T | E | e | 66.2 | 4mm3_B | TSVK |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | ||
1852 | T | e | 23.4 | 4mm3_B | metal NA | VFTSAQ |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | ||
1853 | T | e | 88.3 | 4mm3_B | DTSIKA |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | |||
1854 | I | e | 51.5 | 4mm3_B | SCIKPF |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | |||
1855 | K | e | 80.2 | 4mm3_B | KNDVM |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | |||
1856 | P | e | 92.2 | 7lfv_B | PVLS |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | |||
1857 | V | - | - | - | - | VTE |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | ||
1858 | S | - | - | - | - | TSIVRN |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | ||
1859 | Y | - | - | - | - | YNF |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | ||
1860 | K | - | - | - | - | YKQSDF |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | ||
1861 | L | - | - | - | - | L |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | ||
1862 | D | - | - | - | - | D |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | ||
1863 | G | - | - | - | - | GDT |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | ||
1864 | V | - | - | - | - | VNT |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | ||
1865 | T | - | - | - | - | KTPFEVI |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | ||
1866 | Y | - | - | - | - | KCRYWM |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | ||
1867 | T | - | - | - | - | TVEAI |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | ||
1868 | E | - | - | - | - | EATD |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | ||
1869 | I | - | - | - | - | VIY |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | ||
1870 | E | - | - | - | - | KDNEQ |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | ||
1871 | P | - | - | - | - | PE |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | ||
1872 | K | - | - | - | - | DK |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | ||
1873 | L | - | - | - | - | LF |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | ||
1874 | D | - | - | - | - | SDN |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | ||
1875 | G | - | - | - | - | AQNGKE |
DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C16" TOPO_DOM /note="Cytoplasmic" | ||
1876 | Y | - | - | - | - | YF |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
1877 | Y | - | - | - | - | YLV |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
1878 | K | - | - | - | - | KCVM |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
1879 | K | - | - | - | - | KDEHR |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
1880 | D | - | - | - | - | DGSN |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
1881 | N | - | - | - | - | GND |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
1882 | A | - | - | - | - | KAVYS |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
1883 | Y | - | - | - | - | YA |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
1884 | Y | - | - | - | - | YF |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
1885 | T | - | - | - | - | TY |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
1886 | E | - | - | - | - | EQKTSLADFGINPRVY |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
1887 | Q | - | - | - | - | KQGPAR |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
1888 | P | - | - | - | - | PDI |
DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" | ||
1889 | I | - | - | - | - | IV |
DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" | ||
1890 | D | - | - | - | - | DKEIT |
DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" | ||
1891 | L | - | - | - | - | YLKTAV |
DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" | ||
1892 | V | - | - | - | - | VSAFI |
DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" | ||
1893 | P | - | - | - | - | PQKRADEFGILNSTV |
DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" | ||
1894 | T | - | - | - | - | ATFN |
DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" | ||
1895 | Q | - | - | - | - | TQFARK |
DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" | ||
1896 | P | - | - | - | - | PIET |
DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" | ||
1897 | L | - | - | - | - | LKFYM |
DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" | ||
1898 | P | - | - | - | - | PAVELS |
DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" | ||
1899 | N | - | - | - | - | GNDKV |
DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" | ||
1900 | A | - | - | - | - | SAGTV |
DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" | ||
1901 | S | - | - | - | - | VSE |
DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" | ||
1902 | F | - | - | - | - | YF |
DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" | ||
1903 | D | - | - | - | - | TDS |
DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" | ||
1904 | N | - | - | - | - | NG |
DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" | ||
1905 | F | - | - | - | - | FS |
DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" | ||
1906 | K | - | - | - | - | KCY |
DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" | ||
1907 | L | - | - | - | - | LF |
DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" | ||
1908 | T | - | - | - | - | VTSI |
DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" | ||
1909 | C | - | - | - | - | CGSIAEKLTVDFHMNPQRY |
DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" | ||
1910 | S | - | - | - | - | SQGVHDAEKLTCFIMNPRY |
DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" | ||
1911 | N | - | - | - | - | NGDS |
DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" | ||
1912 | T | - | - | - | - | HGTIPD |
DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" | ||
1913 | K | - | - | - | - | KQTSADEGLV |
DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" | ||
1914 | F | - | - | - | - | IFPLAEGSV |
DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" | ||
1915 | A | - | - | - | - | AGCS |
DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" | ||
1916 | D | - | - | - | - | DESGA |
DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" | ||
1917 | D | - | - | - | - | DSKIQ |
DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" | ||
1918 | L | - | - | - | - | LF |
DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" | ||
1919 | N | - | - | - | - | N |
DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" | ||
1920 | Q | - | - | - | - | AQNDK |
DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" | ||
1921 | M | - | - | - | - | KLMA |
DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" | ||
1922 | T | - | - | - | - | LTI |
DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" | ||
1923 | G | - | - | - | - | GN |
DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" | ||
1924 | F | - | - | - | - | FAY |
DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" | ||
1925 | T | - | - | - | - | TSCKN |
DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" | ||
1926 | K | - | - | - | - | KNSV |
DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" | ||
1927 | P | - | - | - | - | PSTKD |
DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" | ||
1928 | A | - | - | - | - | APVGEIL |
DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" | ||
1929 | S | - | - | - | - | SFPT |
DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" | ||
1930 | R | - | - | - | - | KRVMT |
DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" | ||
1931 | E | - | - | - | - | EK |
DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" | ||
1932 | L | - | - | - | - | LY |
DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" | ||
1933 | S | - | - | - | - | KTSADEFGILNPQRV |
DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" | ||
1934 | V | - | - | - | - | VYIL |
DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" | ||
1935 | T | - | - | - | - | TS |
DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" | ||
1936 | F | - | - | - | - | FEMLV |
DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" | ||
1937 | F | - | - | - | - | WFLY |
DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" | ||
1938 | P | - | - | - | - | P |
DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" | ||
1939 | D | - | - | - | - | DTNKV |
DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" | ||
1940 | L | - | - | - | - | ALEVF |
DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" | ||
1941 | N | - | - | - | - | TNDAE |
DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" | ||
1942 | G | - | - | - | - | G |
DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" | ||
1943 | D | - | - | - | - | D |
DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" | ||
1944 | V | - | - | - | - | V |
DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" | ||
1945 | V | - | - | - | - | VLI |
DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" | ||
1946 | A | - | - | - | - | LA |
DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" | ||
1947 | I | - | - | - | - | AIST |
DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" | ||
1948 | D | - | - | - | - | SEDT |
DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" | ||
1949 | Y | - | - | - | - | DYF |
DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" | ||
1950 | R | - | - | - | - | DRSK |
DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" | ||
1951 | H | - | - | - | - | LHNT |
DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" | ||
1952 | Y | - | - | - | - | YV |
DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" | ||
1953 | S | - | - | - | - | VDSNT |
DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" | ||
1954 | A | - | - | - | - | PASKT |
DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" | ||
1955 | S | - | - | - | - | RSIHV |
DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" | ||
1956 | F | - | - | - | - | YFADEGIKLNPQRSTV |
DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" | ||
1957 | K | - | - | - | - | KSPEF |
DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" | ||
1958 | K | - | - | - | - | KNGYRS |
DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" | ||
1959 | G | - | - | - | - | G |
DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" | ||
1960 | A | - | - | - | - | ACSV |
DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" | ||
1961 | K | - | - | - | - | MKILVE |
DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" | ||
1962 | L | - | - | - | - | LTHY |
DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" | ||
1963 | L | - | - | - | - | FLKMHV |
DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" | ||
1964 | H | - | - | - | - | GH |
DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" | ||
1965 | K | - | - | - | - | K |
DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" | ||
1966 | P | - | - | - | - | P |
DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" | ||
1967 | I | - | - | - | - | IV |
DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" | ||
1968 | V | - | - | - | - | LIV |
DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" | ||
1969 | W | - | - | - | - | WF |
DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" | ||
1970 | H | - | - | - | - | HLVRAGSDEFIKMNPQTY |
DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" | ||
1971 | I | - | - | - | - | INVESCGADFKLPQRT |
DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" | ||
1972 | N | - | - | - | - | NHEADFGIKLPQRSTV |
DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" | ||
1973 | Q | - | - | - | - | QEAGKSDNFILPRTV |
DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" | ||
1974 | A | - | - | - | - | AESKTQVDFGILNPR |
DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" | ||
1975 | T | - | - | - | - | ATLSCFDEGIKNPQRV |
DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" | ||
1976 | T | - | - | - | - | SDNKTYAEFGILPQRV |
DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" | ||
1977 | K | - | - | - | - | SKLDAEFGINPQRTV |
DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" | ||
1978 | T | - | - | - | - | TANLKDEFGIPQRSV |
DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" | ||
1979 | T | - | - | - | - | TSLVN |
DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" | ||
1980 | F | - | - | - | - | LYNTF |
DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" | ||
1981 | K | - | - | - | - | KRT |
DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" | ||
1982 | P | - | - | - | - | PFLADEGIKNQRSTVY |
DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" | ||
1983 | N | - | - | - | - | NSLADEFGIKPQRTVY |
DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" | ||
1984 | T | - | - | - | - | TRVILADEFGKNPQSY |
DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" | ||
1985 | W | - | - | - | - | WAVLDEFGIKNPQRSTY |
DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" | ||
1986 | C | - | - | - | - | CSKTLADEFGINPQRVY |
DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" | ||
1987 | L | - | - | - | - | LEIADFGKNPQRSTVY |
DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" | ||
1988 | R | - | - | - | - | RNVLADEFGIKPQSTY |
DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" | ||
1989 | C | - | - | - | - | QCPAGLSDEIKNRTVFHMY |
DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" | ||
1990 | L | - | - | - | - | LKIVADEFGNPQRSTY |
DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" | ||
1991 | W | - | - | - | - | YFWL |
DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" | ||
1992 | S | - | - | - | - | SDNF |
DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" | ||
1993 | T | - | - | - | - | TVNI |
DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" | ||
1994 | K | - | - | - | - | KALVR |
DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" | ||
1995 | P | - | - | - | - | PV |
DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" | ||
1996 | V | - | - | - | - | VIF |
DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" | ||
1997 | D | - | - | - | - | DENTVK |
DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" | ||
1998 | T | - | - | - | - | TLVSAEG |
DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nucleic acid-binding" TOPO_DOM /note="Cytoplasmic" | ||
1999 | S | - | - | - | - | SEPD |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
2000 | N | - | - | - | - | NE |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
2001 | S | - | - | - | - | KSPTR |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
2002 | F | - | - | - | - | FYT |
TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
2003 | E | - | - | - | - | DTES |
TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
2004 | V | - | - | - | - | VAPK |
TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
2005 | L | - | - | - | - | LIAV |
TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
2006 | A | - | - | - | - | ASQKLEV |
TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
2007 | V | - | - | - | - | VDTS |
TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
2008 | E | - | - | - | - | EDNLTAGSV |
TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
2009 | D | - | - | - | - | DPSQTGVAEL |
TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
2010 | T | - | - | - | - | TVLISAGE |
TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
2011 | Q | - | - | - | - | QDGPTLAEIKRSVCFHMNY |
TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
2012 | G | - | - | - | - | GADQLSVEFIKNPRTCHMWY |
TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
2013 | M | - | - | - | - | MGVLAKSDEFINPQRTCHWY |
TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
2014 | D | - | - | - | - | DEGSLAIKPRTVCFHMNQY |
TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
2015 | N | - | - | - | - | NQSVDGLAEIKPRTCFHMY |
TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
2016 | L | - | - | - | - | LKEIVADGPRSTCFHMNQY |
TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
2017 | A | - | - | - | - | ASLGDEFIKMNPQRTVY |
TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
2018 | C | - | - | - | - | CPVETLADGIKRSFHMNQY |
TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
2019 | E | - | - | - | - | EAGLSDFIKMNPQRTVY |
TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
2020 | S | - | - | - | - | SDHPAGLEFIKMNQRTVY |
TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
2021 | Q | - | - | - | - | QDANGLESFIKMPRTVY |
TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
2022 | Q | - | - | - | - | TKAGQVSDLEFIMNPRY |
TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
2023 | P | - | - | - | - | PKNVAQT |
DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" | ||
2024 | T | - | - | - | - | VTEQK |
DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" | ||
2025 | S | - | - | - | - | SVENDP |
DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" | ||
2026 | E | - | - | - | - | EPTNQDK |
DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" | ||
2027 | E | - | - | - | - | EDPQSIK |
DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" | ||
2028 | V | - | - | - | - | VTI |
DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" | ||
2029 | V | - | - | - | - | VMSACRLDEFGIKNPQTY |
DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" | ||
2030 | E | - | - | - | - | EDAQLFGIKNPRSTVY |
DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" | ||
2031 | N | - | - | - | - | NESVDAGLFHIKMPQRTY |
DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" | ||
2032 | P | - | - | - | - | PINQVDAL |
DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" | ||
2033 | T | - | - | - | - | ITSADL |
DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" | ||
2034 | I | - | - | - | - | ISVLNTA |
DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" | ||
2035 | Q | - | - | - | - | QVKTS |
DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" | ||
2036 | K | - | - | - | - | KLQRD |
DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" | ||
2037 | E | - | - | - | - | EKAPSDQ |
DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" | ||
2038 | V | - | - | - | - | VIPGLS |
DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" | ||
2039 | I | - | - | - | - | IVLSK |
DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" | ||
2040 | E | - | - | - | - | KEPVLS |
DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" | ||
2041 | C | - | - | - | - | CVLGTNAES |
DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" | ||
2042 | D | - | - | - | - | KDGVNTAELS |
DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" | ||
2043 | V | - | - | - | - | VLCRAEGST |
DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" | ||
2044 | K | - | - | - | - | KNA |
DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" | ||
2045 | T | - | - | - | - | TKAGPVE |
DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" | ||
2046 | T | - | - | - | - | TVPFLKI |
DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" | ||
2047 | E | - | - | - | - | EKFMN |
DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" | ||
2048 | V | - | - | - | - | VIL |
DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" | ||
2049 | V | - | - | - | - | KVELN |
DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" | ||
2050 | G | - | - | - | - | GDNL |
DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" | ||
2051 | N | - | - | - | - | NGSAD |
DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" | ||
2052 | V | - | - | - | - | VITFYG |
DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" | ||
2053 | I | - | - | - | - | ISVT |
DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" | ||
2054 | L | - | - | - | - | VFLYK |
DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" | ||
2055 | K | - | - | - | - | VKN |
DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" | ||
2056 | P | - | - | - | - | PDNA |
DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" | ||
2057 | S | - | - | - | - | DPSGEA |
DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" | ||
2058 | D | - | - | - | - | NTDPE |
DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" | ||
2059 | E | - | - | - | - | SENKQ |
DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" | ||
2060 | G | - | - | - | - | GES |
DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" | ||
2061 | V | - | - | - | - | VTLI |
DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" | ||
2062 | K | - | - | - | - | KLNPT |
DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" | ||
2063 | V | - | - | - | - | VCYI |
DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" | ||
2064 | T | - | - | - | - | VTLI |
DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" | ||
2065 | Q | - | - | - | - | KQDE |
DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" | ||
2066 | E | - | - | - | - | ESTY |
DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" | ||
2067 | L | - | - | - | - | LFV |
DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" | ||
2068 | G | - | - | - | - | SGTD |
DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" | ||
2069 | H | - | - | - | - | ILHK |
DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" | ||
2070 | E | - | - | - | - | VTED |
DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" | ||
2071 | D | - | - | - | - | DE |
DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" | ||
2072 | L | - | - | - | - | LV |
DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" | ||
2073 | M | - | - | - | - | YMRQHW |
DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" | ||
2074 | A | - | - | - | - | ADT |
DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" | ||
2075 | A | - | - | - | - | MLAF |
DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" | ||
2076 | Y | - | - | - | - | YFW |
DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" | ||
2077 | V | - | - | - | - | VL |
DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" | ||
2078 | E | - | - | - | - | TDE |
DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" | ||
2079 | N | - | - | - | - | GNEK |
DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" | ||
2080 | T | - | - | - | - | CTVLYS |
DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" | ||
2081 | S | - | - | - | - | RSQDK |
DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" | ||
2082 | I | - | - | - | - | YILFV |
DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" | ||
2083 | T | - | - | - | - | VIT |
DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" | ||
2084 | I | - | - | - | - | VIL |
DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" | ||
2085 | K | - | - | - | - | LWKR |
DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" | ||
2086 | K | - | - | - | - | KTRVM |
DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" | ||
2087 | P | - | - | - | - | APDE |
DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" | ||
2088 | N | - | - | - | - | NS |
DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" | ||
2089 | E | - | - | - | - | ENHDV |
DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" | ||
2090 | L | - | - | - | - | LW |
DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" | ||
2091 | S | - | - | - | - | S |
DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" | ||
2092 | L | - | - | - | - | RLSKAM |
DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" | ||
2093 | A | - | - | - | - | LAVM |
DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" | ||
2094 | L | - | - | - | - | LVFI |
DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" | ||
2095 | G | - | - | - | - | GNKR |
DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" | ||
2096 | L | - | - | - | - | LSVI |
DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" | ||
2097 | K | - | - | - | - | PRHKS |
DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" | ||
2098 | T | - | - | - | - | TV |
DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" | ||
2099 | I | - | - | - | - | VLIADEFGKNPQRSTY |
DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" | ||
2100 | A | - | - | - | - | AERILDFGKNPQSTVY |
DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" | ||
2101 | T | - | - | - | - | STKEV |
DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" | ||
2102 | H | - | - | - | - | HYTDGFAEKLSV |
DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" | ||
2103 | G | - | - | - | - | GASDIELVFHKMNPQRTY |
DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" | ||
2104 | I | - | - | - | - | ISARLMEGVDFHKNPQTY |
DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" | ||
2105 | A | - | - | - | - | AVLGTYDEFIKNPQRS |
DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" | ||
2106 | A | - | - | - | - | AVHDGLEFIKNPQRSTY |
DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" | ||
2107 | I | - | - | - | - | VISADEFGKLNPQRTY |
DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" | ||
2108 | N | - | - | - | - | NGKALSVDEFHIMPQRTY |
DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" | ||
2109 | S | - | - | - | - | SGHVPADEFIKLNQRTY |
DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" | ||
2110 | V | - | - | - | - | VICL |
DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" | ||
2111 | P | - | - | - | - | PTKVSA |
DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" | ||
2112 | W | - | - | - | - | WTIKAR |
DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" | ||
2113 | S | - | - | - | - | SGDRPT |
DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" | ||
2114 | K | - | - | - | - | KNVGILT |
DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" | ||
2115 | I | - | - | - | - | IVLSD |
DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" | ||
2116 | L | - | - | - | - | LVYAIDEFGKNPQRST |
DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" | ||
2117 | A | - | - | - | - | ALTIRNDEFGKPQSV |
DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" | ||
2118 | Y | - | - | - | - | YPGRCEADFIKLNQSTV |
DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" | ||
2119 | V | - | - | - | - | AVKLIDEFGNPQRST |
DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" | ||
2120 | K | - | - | - | - | KSVRNAEGLTCDFHIMPQY |
DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" | ||
2121 | P | - | - | - | - | PLKSDAEGINRTV |
DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" | ||
2122 | F | - | - | - | - | LFTVADEGIKNPQRSY |
DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" | ||
2123 | L | - | - | - | - | LFIDAEGKNPRSTV |
DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" | ||
2124 | G | - | - | - | - | GLVNAFDEIKPQRSTY |
DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" | ||
2125 | Q | - | - | - | - | QRSKLADEFGINPTVY |
DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" | ||
2126 | A | - | - | - | - | ADETFVLGIKNPQRSY |
DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" | ||
2127 | A | - | - | - | - | AEKSLVDFGINPQRTY |
DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" | ||
2128 | I | - | - | - | - | IKSVFLADEGNPQRTY |
DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" | ||
2129 | T | - | - | - | - | TVQSAILDEFGKNPRY |
DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" | ||
2130 | T | - | - | - | - | TVEPLADFGIKNQRSY |
DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" | ||
2131 | S | - | - | - | - | FMSTGVKLADEINPQRY |
DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" | ||
2132 | N | - | - | - | - | NVDSIAEGKLPRT |
DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="G2M" TOPO_DOM /note="Cytoplasmic" | ||
2133 | C | - | - | - | - | CAVKFIDEGLNPRST |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
2134 | A | - | - | - | - | AIPLVTK |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
2135 | K | - | - | - | - | KTDA |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
2136 | R | - | - | - | - | RVTSAK |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
2137 | L | - | - | - | - | VLCGMA |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
2138 | A | - | - | - | - | VTAKIRL |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
2139 | Q | - | - | - | - | QRANTE |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
2140 | R | - | - | - | - | KRNHAGLS |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
2141 | V | - | - | - | - | VFALIMGS |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
2142 | F | - | - | - | - | FICTS |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
2143 | N | - | - | - | - | TAQNFYS |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
2144 | N | - | - | - | - | NSCGADEFIKLPQRTV |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
2145 | Y | - | - | - | - | YFLI |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
2146 | M | - | - | - | - | MGLIVC |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
2147 | P | - | - | - | - | KPGDA |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
2148 | Y | - | - | - | - | YWFGVMQ |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
2149 | V | - | - | - | - | LVFKG |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
2150 | F | - | - | - | - | FMVWIL |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
2151 | T | - | - | - | - | TNSFAMIVL |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
2152 | L | - | - | - | - | LNYR |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
2153 | L | - | - | - | - | LVIPC |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
2154 | F | - | - | - | - | FLAVRYK |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
2155 | Q | - | - | - | - | QILSCKAMG |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
2156 | L | - | - | - | - | LFCWTY |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
2157 | C | - | - | - | - | LCFIAS |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
2158 | T | - | - | - | - | TRKDWSH |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
2159 | F | - | - | - | - | FIAWD |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
2160 | T | - | - | - | - | TLSKVW |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
2161 | K | - | - | - | - | KRLFANT |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
2162 | S | - | - | - | - | SDKNLE |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
2163 | T | - | - | - | - | TKMRGNV |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
2164 | N | - | - | - | - | NDTFAL |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
2165 | S | - | - | - | - | SMPNTADEGIKLQRV |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
2166 | R | - | - | - | - | KRLQETADGINPSV |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
2167 | I | - | - | - | - | VLIADEGKNPQRST |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
2168 | R | - | - | - | - | KRMFITAL |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
2169 | A | - | - | - | - | AVMYIFDEGKLNPRST |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
2170 | S | - | - | - | - | SGRTEFINADKLPV |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
2171 | L | - | - | - | - | LVYFAMGSDEIKNPQRT |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
2172 | P | - | - | - | - | PTGLWCASDEFIKNQRVY |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
2173 | T | - | - | - | - | TELAKC |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
2174 | T | - | - | - | - | TLEAIS |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
2175 | I | - | - | - | - | IVRA |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
2176 | A | - | - | - | - | ATLKMF |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
2177 | K | - | - | - | - | KSTAG |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
2178 | N | - | - | - | - | NGRHPKADEFILQSTV |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
2179 | S | - | - | - | - | SDPIVFATEGKLNQR |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
2180 | V | - | - | - | - | VITLADEFGKNPQRS |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
2181 | K | - | - | - | - | KVTFQR |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
2182 | S | - | - | - | - | SLTIKVQNGADEPR |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
2183 | V | - | - | - | - | VTIMCLFADEGKPRS |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
2184 | A | - | - | - | - | AFCVSGNDEIKLPRT |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
2185 | K | - | - | - | - | KGTCRWADEILPSV |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
2186 | L | - | - | - | - | LAIQFNDEGKPRSTV |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
2187 | C | - | - | - | - | CAPVDEGIKLRST |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
2188 | L | - | - | - | - | LAVKQYCDEGIPRST |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
2189 | D | - | - | - | - | DRLSNKEAGIPTV |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
2190 | A | - | - | - | - | ATLVNRDEGIKPS |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
2191 | G | - | - | - | - | GAFSCDEIKLPRTV |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
2192 | I | - | - | - | - | VYIFKLM |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
2193 | N | - | - | - | - | NDVIQF |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
2194 | Y | - | - | - | - | YLAKTGSV |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
2195 | V | - | - | - | - | LVKFT |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
2196 | K | - | - | - | - | RKALQ |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
2197 | S | - | - | - | - | STLRVW |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
2198 | P | - | - | - | - | FPSVKL |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
2199 | K | - | - | - | - | KNFRDI |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
2200 | F | - | - | - | - | FWYL |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
2201 | S | - | - | - | - | SKFLNI |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
2202 | K | - | - | - | - | KRAGLSV |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
2203 | L | - | - | - | - | LKVFITG |
TRANSMEM /note="Helical" REGION /note="HD1" TRANSMEM /note="Helical" REGION /note="HD1" | ||
2204 | F | - | - | - | - | FLADI |
TRANSMEM /note="Helical" REGION /note="HD1" TRANSMEM /note="Helical" REGION /note="HD1" | ||
2205 | T | - | - | - | - | RLTQSVWN |
TRANSMEM /note="Helical" REGION /note="HD1" TRANSMEM /note="Helical" REGION /note="HD1" | ||
2206 | I | - | - | - | - | IYVLAKG |
TRANSMEM /note="Helical" REGION /note="HD1" TRANSMEM /note="Helical" REGION /note="HD1" | ||
2207 | A | - | - | - | - | AIVKMLSW |
TRANSMEM /note="Helical" REGION /note="HD1" TRANSMEM /note="Helical" REGION /note="HD1" | ||
2208 | M | - | - | - | - | LMVTFKQCI |
TRANSMEM /note="Helical" REGION /note="HD1" TRANSMEM /note="Helical" REGION /note="HD1" | ||
2209 | W | - | - | - | - | WVYLMIFN |
TRANSMEM /note="Helical" REGION /note="HD1" TRANSMEM /note="Helical" REGION /note="HD1" | ||
2210 | L | - | - | - | - | LFICR |
TRANSMEM /note="Helical" REGION /note="HD1" TRANSMEM /note="Helical" REGION /note="HD1" | ||
2211 | L | - | - | - | - | LVWCA |
TRANSMEM /note="Helical" REGION /note="HD1" TRANSMEM /note="Helical" REGION /note="HD1" | ||
2212 | L | - | - | - | - | LTYAKFIW |
TRANSMEM /note="Helical" REGION /note="HD1" TRANSMEM /note="Helical" REGION /note="HD1" | ||
2213 | L | - | - | - | - | FLVIKTAW |
TRANSMEM /note="Helical" REGION /note="HD1" TRANSMEM /note="Helical" REGION /note="HD1" | ||
2214 | S | - | - | - | - | SFNTWLM |
TRANSMEM /note="Helical" REGION /note="HD1" TRANSMEM /note="Helical" REGION /note="HD1" | ||
2215 | I | - | - | - | - | LIVTFN |
TRANSMEM /note="Helical" REGION /note="HD1" TRANSMEM /note="Helical" REGION /note="HD1" | ||
2216 | C | - | - | - | - | CLFIKV |
TRANSMEM /note="Helical" REGION /note="HD1" TRANSMEM /note="Helical" REGION /note="HD1" | ||
2217 | L | - | - | - | - | LKFWY |
TRANSMEM /note="Helical" REGION /note="HD1" TRANSMEM /note="Helical" REGION /note="HD1" | ||
2218 | G | - | - | - | - | GSFYLTADEKV |
TRANSMEM /note="Helical" REGION /note="HD1" TRANSMEM /note="Helical" REGION /note="HD1" | ||
2219 | S | - | - | - | - | SLDNTAEGKV |
TRANSMEM /note="Helical" REGION /note="HD1" TRANSMEM /note="Helical" REGION /note="HD1" | ||
2220 | L | - | - | - | - | LFVTDN |
TRANSMEM /note="Helical" REGION /note="HD1" TRANSMEM /note="Helical" REGION /note="HD1" | ||
2221 | I | - | - | - | - | IYVLT |
TRANSMEM /note="Helical" REGION /note="HD1" TRANSMEM /note="Helical" REGION /note="HD1" | ||
2222 | C | - | - | - | - | YLCAHMFI |
TRANSMEM /note="Helical" REGION /note="HD1" TRANSMEM /note="Helical" REGION /note="HD1" | ||
2223 | V | - | - | - | - | LVTYAPSDEGK |
TRANSMEM /note="Helical" REGION /note="HD1" TRANSMEM /note="Helical" REGION /note="HD1" | ||
2224 | T | - | - | - | - | TGNALMDYSEKV |
DOMAIN /note="3Ecto" TOPO_DOM /note="Lumenal" REGION /note="HD1" DOMAIN /note="3Ecto" TOPO_DOM /note="Lumenal" REGION /note="HD1" | ||
2225 | A | - | - | - | - | AIVFYGRDQEKLST |
DOMAIN /note="3Ecto" TOPO_DOM /note="Lumenal" REGION /note="HD1" DOMAIN /note="3Ecto" TOPO_DOM /note="Lumenal" REGION /note="HD1" | ||
2226 | A | - | - | - | - | AIFMSYGVDEKLT |
DOMAIN /note="3Ecto" TOPO_DOM /note="Lumenal" REGION /note="HD1" DOMAIN /note="3Ecto" TOPO_DOM /note="Lumenal" REGION /note="HD1" | ||
2227 | F | - | - | - | - | FVLAENYDGKST |
DOMAIN /note="3Ecto" TOPO_DOM /note="Lumenal" REGION /note="HD1" DOMAIN /note="3Ecto" TOPO_DOM /note="Lumenal" REGION /note="HD1" | ||
2228 | G | - | - | - | - | GLVAQSMDEFIKNPRT |
DOMAIN /note="3Ecto" TOPO_DOM /note="Lumenal" REGION /note="HD1" DOMAIN /note="3Ecto" TOPO_DOM /note="Lumenal" REGION /note="HD1" | ||
2229 | V | - | - | - | - | VWILMF |
DOMAIN /note="3Ecto" TOPO_DOM /note="Lumenal" REGION /note="HD1" DOMAIN /note="3Ecto" TOPO_DOM /note="Lumenal" REGION /note="HD1" | ||
2230 | L | - | - | - | - | LRVWFIYC |
DOMAIN /note="3Ecto" TOPO_DOM /note="Lumenal" REGION /note="HD1" DOMAIN /note="3Ecto" TOPO_DOM /note="Lumenal" REGION /note="HD1" | ||
2231 | L | - | - | - | - | LKMCFAS |
DOMAIN /note="3Ecto" TOPO_DOM /note="Lumenal" REGION /note="HD1" DOMAIN /note="3Ecto" TOPO_DOM /note="Lumenal" REGION /note="HD1" | ||
2232 | S | - | - | - | - | STPVIA |
DOMAIN /note="3Ecto" TOPO_DOM /note="Lumenal" REGION /note="HD1" DOMAIN /note="3Ecto" TOPO_DOM /note="Lumenal" REGION /note="HD1" | ||
2233 | N | - | - | - | - | NTPREVDYKS |
DOMAIN /note="3Ecto" TOPO_DOM /note="Lumenal" REGION /note="HD1" DOMAIN /note="3Ecto" TOPO_DOM /note="Lumenal" REGION /note="HD1" | ||
2234 | F | - | - | - | - | FLIVPQ |
DOMAIN /note="3Ecto" TOPO_DOM /note="Lumenal" REGION /note="HD1" DOMAIN /note="3Ecto" TOPO_DOM /note="Lumenal" REGION /note="HD1" | ||
2235 | G | - | - | - | - | GYF |
DOMAIN /note="3Ecto" TOPO_DOM /note="Lumenal" REGION /note="HD1" DOMAIN /note="3Ecto" TOPO_DOM /note="Lumenal" REGION /note="HD1" | ||
2236 | A | - | - | - | - | IASPLTVM |
DOMAIN /note="3Ecto" TOPO_DOM /note="Lumenal" REGION /note="HD1" DOMAIN /note="3Ecto" TOPO_DOM /note="Lumenal" REGION /note="HD1" | ||
2237 | P | - | - | - | - | PFHSVL |
DOMAIN /note="3Ecto" TOPO_DOM /note="Lumenal" REGION /note="HD1" DOMAIN /note="3Ecto" TOPO_DOM /note="Lumenal" REGION /note="HD1" | ||
2238 | S | - | - | - | - | STFNADEGIKLPQRV |
DOMAIN /note="3Ecto" TOPO_DOM /note="Lumenal" REGION /note="HD1" DOMAIN /note="3Ecto" TOPO_DOM /note="Lumenal" REGION /note="HD1" | ||
2239 | Y | - | - | - | - | LYFIVA |
DOMAIN /note="3Ecto" TOPO_DOM /note="Lumenal" REGION /note="HD1" DOMAIN /note="3Ecto" TOPO_DOM /note="Lumenal" REGION /note="HD1" | ||
2240 | C | - | - | - | - | CV |
DISULFID DOMAIN /note="3Ecto" TOPO_DOM /note="Lumenal" REGION /note="HD1" DISULFID DOMAIN /note="3Ecto" TOPO_DOM /note="Lumenal" REGION /note="HD1" | ||
2241 | N | - | - | - | - | DGSTNK |
DOMAIN /note="3Ecto" TOPO_DOM /note="Lumenal" REGION /note="HD1" DOMAIN /note="3Ecto" TOPO_DOM /note="Lumenal" REGION /note="HD1" | ||
2242 | G | - | - | - | - | GRDPEQFK |
DOMAIN /note="3Ecto" TOPO_DOM /note="Lumenal" REGION /note="HD1" DOMAIN /note="3Ecto" TOPO_DOM /note="Lumenal" REGION /note="HD1" | ||
2243 | V | - | - | - | - | YVIFTALMS |
DOMAIN /note="3Ecto" TOPO_DOM /note="Lumenal" REGION /note="HD1" DOMAIN /note="3Ecto" TOPO_DOM /note="Lumenal" REGION /note="HD1" | ||
2244 | R | - | - | - | - | VKRATS |
DOMAIN /note="3Ecto" TOPO_DOM /note="Lumenal" REGION /note="HD1" DOMAIN /note="3Ecto" TOPO_DOM /note="Lumenal" REGION /note="HD1" | ||
2245 | E | - | - | - | - | DEQSAYNK |
DOMAIN /note="3Ecto" TOPO_DOM /note="Lumenal" REGION /note="HD1" DOMAIN /note="3Ecto" TOPO_DOM /note="Lumenal" REGION /note="HD1" | ||
2246 | L | - | - | - | - | GALYWFS |
DOMAIN /note="3Ecto" TOPO_DOM /note="Lumenal" REGION /note="HD1" DOMAIN /note="3Ecto" TOPO_DOM /note="Lumenal" REGION /note="HD1" | ||
2247 | Y | - | - | - | - | YGLIF |
DOMAIN /note="3Ecto" TOPO_DOM /note="Lumenal" REGION /note="HD1" DOMAIN /note="3Ecto" TOPO_DOM /note="Lumenal" REGION /note="HD1" | ||
2248 | L | - | - | - | - | AKVLERSQYI |
DOMAIN /note="3Ecto" TOPO_DOM /note="Lumenal" REGION /note="HD1" DOMAIN /note="3Ecto" TOPO_DOM /note="Lumenal" REGION /note="HD1" | ||
2249 | N | - | - | - | - | NDMKGSRTVL |
DOMAIN /note="3Ecto" TOPO_DOM /note="Lumenal" REGION /note="HD1" DOMAIN /note="3Ecto" TOPO_DOM /note="Lumenal" REGION /note="HD1" | ||
2250 | S | - | - | - | - | STKPV |
DOMAIN /note="3Ecto" TOPO_DOM /note="Lumenal" REGION /note="HD1" DOMAIN /note="3Ecto" TOPO_DOM /note="Lumenal" REGION /note="HD1" | ||
2251 | S | - | - | - | - | SFTCD |
DOMAIN /note="3Ecto" TOPO_DOM /note="Lumenal" REGION /note="HD1" DOMAIN /note="3Ecto" TOPO_DOM /note="Lumenal" REGION /note="HD1" | ||
2252 | N | - | - | - | - | DNFSGVAELTHIKMPQRY |
DOMAIN /note="3Ecto" TOPO_DOM /note="Lumenal" REGION /note="HD1" DOMAIN /note="3Ecto" TOPO_DOM /note="Lumenal" REGION /note="HD1" | ||
2253 | V | - | - | - | - | VFYINLGAES |
DOMAIN /note="3Ecto" TOPO_DOM /note="Lumenal" REGION /note="HD1" DOMAIN /note="3Ecto" TOPO_DOM /note="Lumenal" REGION /note="HD1" | ||
2254 | T | - | - | - | - | DVKTPFSYAEGILNQR |
DOMAIN /note="3Ecto" TOPO_DOM /note="Lumenal" REGION /note="HD1" DOMAIN /note="3Ecto" TOPO_DOM /note="Lumenal" REGION /note="HD1" | ||
2255 | T | - | - | - | - | TKSLDVIRAEFGNPQ |
DOMAIN /note="3Ecto" TOPO_DOM /note="Lumenal" REGION /note="HD1" DOMAIN /note="3Ecto" TOPO_DOM /note="Lumenal" REGION /note="HD1" | ||
2256 | M | - | - | - | - | NILMASVDEFGKPQRT |
DOMAIN /note="3Ecto" TOPO_DOM /note="Lumenal" REGION /note="HD1" DOMAIN /note="3Ecto" TOPO_DOM /note="Lumenal" REGION /note="HD1" | ||
2257 | D | - | - | - | - | DRENSHQTAGLFIKPVY |
DOMAIN /note="3Ecto" TOPO_DOM /note="Lumenal" REGION /note="HD1" DOMAIN /note="3Ecto" TOPO_DOM /note="Lumenal" REGION /note="HD1" | ||
2258 | F | - | - | - | - | YFVE |
DOMAIN /note="3Ecto" TOPO_DOM /note="Lumenal" REGION /note="HD1" DOMAIN /note="3Ecto" TOPO_DOM /note="Lumenal" REGION /note="HD1" | ||
2259 | C | - | - | - | - | CT |
DISULFID DOMAIN /note="3Ecto" TOPO_DOM /note="Lumenal" REGION /note="HD1" DISULFID DOMAIN /note="3Ecto" TOPO_DOM /note="Lumenal" REGION /note="HD1" | ||
2260 | E | - | - | - | - | GNAEDSTQL |
DOMAIN /note="3Ecto" TOPO_DOM /note="Lumenal" REGION /note="HD1" DOMAIN /note="3Ecto" TOPO_DOM /note="Lumenal" REGION /note="HD1" | ||
2261 | G | - | - | - | - | GNDTL |
DOMAIN /note="3Ecto" TOPO_DOM /note="Lumenal" REGION /note="HD1" DOMAIN /note="3Ecto" TOPO_DOM /note="Lumenal" REGION /note="HD1" | ||
2262 | S | - | - | - | - | SDGNY |
DOMAIN /note="3Ecto" TOPO_DOM /note="Lumenal" REGION /note="HD1" DOMAIN /note="3Ecto" TOPO_DOM /note="Lumenal" REGION /note="HD1" | ||
2263 | F | - | - | - | - | FIMVAWL |
DOMAIN /note="3Ecto" TOPO_DOM /note="Lumenal" REGION /note="HD1" DOMAIN /note="3Ecto" TOPO_DOM /note="Lumenal" REGION /note="HD1" | ||
2264 | P | - | - | - | - | LIVPGMTA |
DOMAIN /note="3Ecto" TOPO_DOM /note="Lumenal" REGION /note="HD1" DOMAIN /note="3Ecto" TOPO_DOM /note="Lumenal" REGION /note="HD1" | ||
2265 | C | - | - | - | - | CH |
DISULFID DOMAIN /note="3Ecto" TOPO_DOM /note="Lumenal" REGION /note="HD1" DISULFID DOMAIN /note="3Ecto" TOPO_DOM /note="Lumenal" REGION /note="HD1" | ||
2266 | S | - | - | - | - | KESRNHQ |
DOMAIN /note="3Ecto" TOPO_DOM /note="Lumenal" REGION /note="HD1" DOMAIN /note="3Ecto" TOPO_DOM /note="Lumenal" REGION /note="HD1" | ||
2267 | I | - | - | - | - | VLMAWIF |
DOMAIN /note="3Ecto" TOPO_DOM /note="Lumenal" REGION /note="HD1" DOMAIN /note="3Ecto" TOPO_DOM /note="Lumenal" REGION /note="HD1" | ||
2268 | C | - | - | - | - | C |
DISULFID DOMAIN /note="3Ecto" TOPO_DOM /note="Lumenal" REGION /note="HD1" DISULFID DOMAIN /note="3Ecto" TOPO_DOM /note="Lumenal" REGION /note="HD1" | ||
2269 | L | - | - | - | - | LFMY |
DOMAIN /note="3Ecto" TOPO_DOM /note="Lumenal" REGION /note="HD1" DOMAIN /note="3Ecto" TOPO_DOM /note="Lumenal" REGION /note="HD1" | ||
2270 | S | - | - | - | - | SAHFYIN |
DOMAIN /note="3Ecto" TOPO_DOM /note="Lumenal" REGION /note="HD1" DOMAIN /note="3Ecto" TOPO_DOM /note="Lumenal" REGION /note="HD1" | ||
2271 | G | - | - | - | - | GSDL |
DOMAIN /note="3Ecto" TOPO_DOM /note="Lumenal" REGION /note="HD1" DOMAIN /note="3Ecto" TOPO_DOM /note="Lumenal" REGION /note="HD1" | ||
2272 | L | - | - | - | - | YFLQKMR |
DOMAIN /note="3Ecto" TOPO_DOM /note="Lumenal" REGION /note="HD1" DOMAIN /note="3Ecto" TOPO_DOM /note="Lumenal" REGION /note="HD1" | ||
2273 | D | - | - | - | - | DQEL |
DOMAIN /note="3Ecto" TOPO_DOM /note="Lumenal" REGION /note="HD1" DOMAIN /note="3Ecto" TOPO_DOM /note="Lumenal" REGION /note="HD1" | ||
2274 | S | - | - | - | - | SEML |
DOMAIN /note="3Ecto" TOPO_DOM /note="Lumenal" REGION /note="HD1" DOMAIN /note="3Ecto" TOPO_DOM /note="Lumenal" REGION /note="HD1" | ||
2275 | L | - | - | - | - | LI |
DOMAIN /note="3Ecto" TOPO_DOM /note="Lumenal" REGION /note="HD1" DOMAIN /note="3Ecto" TOPO_DOM /note="Lumenal" REGION /note="HD1" | ||
2276 | D | - | - | - | - | DSHATL |
DOMAIN /note="3Ecto" TOPO_DOM /note="Lumenal" REGION /note="HD1" DOMAIN /note="3Ecto" TOPO_DOM /note="Lumenal" REGION /note="HD1" | ||
2277 | S | - | - | - | - | DSNLTHQRAG |
DOMAIN /note="3Ecto" TOPO_DOM /note="Lumenal" REGION /note="HD1" DOMAIN /note="3Ecto" TOPO_DOM /note="Lumenal" REGION /note="HD1" | ||
2278 | Y | - | - | - | - | YF |
DOMAIN /note="3Ecto" TOPO_DOM /note="Lumenal" REGION /note="HD1" DOMAIN /note="3Ecto" TOPO_DOM /note="Lumenal" REGION /note="HD1" | ||
2279 | P | - | - | - | - | PSKDQTAEL |
DOMAIN /note="3Ecto" TOPO_DOM /note="Lumenal" REGION /note="HD1" DOMAIN /note="3Ecto" TOPO_DOM /note="Lumenal" REGION /note="HD1" | ||
2280 | A | - | - | - | - | AHSEL |
DOMAIN /note="3Ecto" TOPO_DOM /note="Lumenal" REGION /note="HD1" DOMAIN /note="3Ecto" TOPO_DOM /note="Lumenal" REGION /note="HD1" | ||
2281 | L | - | - | - | - | LIAFT |
DOMAIN /note="3Ecto" TOPO_DOM /note="Lumenal" REGION /note="HD1" DOMAIN /note="3Ecto" TOPO_DOM /note="Lumenal" REGION /note="HD1" | ||
2282 | E | - | - | - | - | QNDERYK |
DOMAIN /note="3Ecto" TOPO_DOM /note="Lumenal" REGION /note="HD1" DOMAIN /note="3Ecto" TOPO_DOM /note="Lumenal" REGION /note="HD1" | ||
2283 | T | - | - | - | - | VMTSDHF |
DOMAIN /note="3Ecto" TOPO_DOM /note="Lumenal" REGION /note="HD1" DOMAIN /note="3Ecto" TOPO_DOM /note="Lumenal" REGION /note="HD1" | ||
2284 | I | - | - | - | - | VILQS |
DOMAIN /note="3Ecto" TOPO_DOM /note="Lumenal" REGION /note="HD1" DOMAIN /note="3Ecto" TOPO_DOM /note="Lumenal" REGION /note="HD1" | ||
2285 | Q | - | - | - | - | QWEDN |
DOMAIN /note="3Ecto" TOPO_DOM /note="Lumenal" REGION /note="HD1" DOMAIN /note="3Ecto" TOPO_DOM /note="Lumenal" REGION /note="HD1" | ||
2286 | V | - | - | - | - | VHTYKQILADEFGNPRS |
DOMAIN /note="3Ecto" TOPO_DOM /note="Lumenal" REGION /note="HD1" DOMAIN /note="3Ecto" TOPO_DOM /note="Lumenal" REGION /note="HD1" | ||
2287 | T | - | - | - | - | THVERMLADFGIKNPQSY |
DOMAIN /note="3Ecto" TOPO_DOM /note="Lumenal" REGION /note="HD1" DOMAIN /note="3Ecto" TOPO_DOM /note="Lumenal" REGION /note="HD1" | ||
2288 | I | - | - | - | - | ILDVYPSAWEFGKNQRT |
DOMAIN /note="3Ecto" TOPO_DOM /note="Lumenal" REGION /note="HD1" DOMAIN /note="3Ecto" TOPO_DOM /note="Lumenal" REGION /note="HD1" | ||
2289 | S | - | - | - | - | SDQTRGFKL |
DOMAIN /note="3Ecto" TOPO_DOM /note="Lumenal" REGION /note="HD1" DOMAIN /note="3Ecto" TOPO_DOM /note="Lumenal" REGION /note="HD1" | ||
2290 | S | - | - | - | - | SRDVIFHL |
DOMAIN /note="3Ecto" TOPO_DOM /note="Lumenal" REGION /note="HD1" DOMAIN /note="3Ecto" TOPO_DOM /note="Lumenal" REGION /note="HD1" | ||
2291 | Y | - | - | - | - | YFRVWLADEGIKNPQST |
DOMAIN /note="3Ecto" TOPO_DOM /note="Lumenal" REGION /note="HD1" DOMAIN /note="3Ecto" TOPO_DOM /note="Lumenal" REGION /note="HD1" | ||
2292 | K | - | - | - | - | KVPSILA |
DOMAIN /note="3Ecto" TOPO_DOM /note="Lumenal" REGION /note="HD1" DOMAIN /note="3Ecto" TOPO_DOM /note="Lumenal" REGION /note="HD1" | ||
2293 | L | - | - | - | - | LDSFVYAIRW |
DOMAIN /note="3Ecto" TOPO_DOM /note="Lumenal" REGION /note="HD1" DOMAIN /note="3Ecto" TOPO_DOM /note="Lumenal" REGION /note="HD1" | ||
2294 | D | - | - | - | - | DNAFIMY |
DOMAIN /note="3Ecto" TOPO_DOM /note="Lumenal" REGION /note="HD1" DOMAIN /note="3Ecto" TOPO_DOM /note="Lumenal" REGION /note="HD1" | ||
2295 | L | - | - | - | - | ILPAVYG |
TOPO_DOM /note="Lumenal" REGION /note="HD1" TOPO_DOM /note="Lumenal" REGION /note="HD1" | ||
2296 | T | - | - | - | - | STLDAIN |
TOPO_DOM /note="Lumenal" REGION /note="HD1" TOPO_DOM /note="Lumenal" REGION /note="HD1" | ||
2297 | I | - | - | - | - | LWIYVASFDEGKNPQRT |
TOPO_DOM /note="Lumenal" REGION /note="HD1" TOPO_DOM /note="Lumenal" REGION /note="HD1" | ||
2298 | L | - | - | - | - | LFINVADEGKPQRST |
TOPO_DOM /note="Lumenal" REGION /note="HD1" TOPO_DOM /note="Lumenal" REGION /note="HD1" | ||
2299 | G | - | - | - | - | GKRWLIPS |
TOPO_DOM /note="Lumenal" REGION /note="HD1" TOPO_DOM /note="Lumenal" REGION /note="HD1" | ||
2300 | L | - | - | - | - | LFIMV |
TOPO_DOM /note="Lumenal" REGION /note="HD1" TOPO_DOM /note="Lumenal" REGION /note="HD1" | ||
2301 | A | - | - | - | - | VAIGLNFQ |
TOPO_DOM /note="Lumenal" REGION /note="HD1" TOPO_DOM /note="Lumenal" REGION /note="HD1" | ||
2302 | A | - | - | - | - | FAVQLDGMPI |
TOPO_DOM /note="Lumenal" REGION /note="HD1" TOPO_DOM /note="Lumenal" REGION /note="HD1" | ||
2303 | E | - | - | - | - | ENFVLADGIKPQRSTY |
TOPO_DOM /note="Lumenal" REGION /note="HD1" TOPO_DOM /note="Lumenal" REGION /note="HD1" | ||
2304 | W | - | - | - | - | WLYAVFTDEGIKNPRS |
TRANSMEM /note="Helical" REGION /note="HD1" TRANSMEM /note="Helical" REGION /note="HD1" | ||
2305 | V | - | - | - | - | VFLNIAGDEKPRST |
TRANSMEM /note="Helical" REGION /note="HD1" TRANSMEM /note="Helical" REGION /note="HD1" | ||
2306 | L | - | - | - | - | LIWFVKR |
TRANSMEM /note="Helical" REGION /note="HD1" TRANSMEM /note="Helical" REGION /note="HD1" | ||
2307 | A | - | - | - | - | AGSLCFV |
TRANSMEM /note="Helical" REGION /note="HD1" TRANSMEM /note="Helical" REGION /note="HD1" | ||
2308 | Y | - | - | - | - | YIFL |
TRANSMEM /note="Helical" REGION /note="HD1" TRANSMEM /note="Helical" REGION /note="HD1" | ||
2309 | M | - | - | - | - | LMSFITVA |
TRANSMEM /note="Helical" REGION /note="HD1" TRANSMEM /note="Helical" REGION /note="HD1" | ||
2310 | L | - | - | - | - | LVIA |
TRANSMEM /note="Helical" REGION /note="HD1" TRANSMEM /note="Helical" REGION /note="HD1" | ||
2311 | F | - | - | - | - | FY |
TRANSMEM /note="Helical" REGION /note="HD1" TRANSMEM /note="Helical" REGION /note="HD1" | ||
2312 | T | - | - | - | - | TLGF |
TRANSMEM /note="Helical" REGION /note="HD1" TRANSMEM /note="Helical" REGION /note="HD1" | ||
2313 | K | - | - | - | - | IAVKSPGNRL |
TRANSMEM /note="Helical" REGION /note="HD1" TRANSMEM /note="Helical" REGION /note="HD1" | ||
2314 | F | - | - | - | - | FALVCWMT |
TRANSMEM /note="Helical" REGION /note="HD1" TRANSMEM /note="Helical" REGION /note="HD1" | ||
2315 | F | - | - | - | - | FLQY |
TRANSMEM /note="Helical" REGION /note="HD1" TRANSMEM /note="Helical" REGION /note="HD1" | ||
2316 | Y | - | - | - | - | YVGNPFL |
TRANSMEM /note="Helical" REGION /note="HD1" TRANSMEM /note="Helical" REGION /note="HD1" | ||
2317 | L | - | - | - | - | LVPRIWADEGKNST |
TRANSMEM /note="Helical" REGION /note="HD1" TRANSMEM /note="Helical" REGION /note="HD1" | ||
2318 | L | - | - | - | - | LVAFINDEGKPRST |
TRANSMEM /note="Helical" REGION /note="HD1" TRANSMEM /note="Helical" REGION /note="HD1" | ||
2319 | G | - | - | - | - | GLFQSADEIKNPRTV |
TRANSMEM /note="Helical" REGION /note="HD1" TRANSMEM /note="Helical" REGION /note="HD1" | ||
2320 | L | - | - | - | - | LIFSVMACDEGKNPRT |
TRANSMEM /note="Helical" REGION /note="HD1" TRANSMEM /note="Helical" REGION /note="HD1" | ||
2321 | S | - | - | - | - | LSNAIGTV |
TRANSMEM /note="Helical" REGION /note="HD1" TRANSMEM /note="Helical" REGION /note="HD1" | ||
2322 | A | - | - | - | - | AINYGVSTDEKLPQR |
TRANSMEM /note="Helical" REGION /note="HD1" TRANSMEM /note="Helical" REGION /note="HD1" | ||
2323 | I | - | - | - | - | IVTFGYSADEKLNPQR |
TRANSMEM /note="Helical" REGION /note="HD1" TRANSMEM /note="Helical" REGION /note="HD1" | ||
2324 | M | - | - | - | - | MLVISADEGKNPQRT |
TRANSMEM /note="Helical" REGION /note="HD1" TRANSMEM /note="Helical" REGION /note="HD1" | ||
2325 | Q | - | - | - | - | QHRAGMDEIKLNPSTV |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
2326 | V | - | - | - | - | VLQCYTIA |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
2327 | F | - | - | - | - | FLIGY |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
2328 | F | - | - | - | - | FLTIV |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
2329 | G | - | - | - | - | GTSMLACN |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
2330 | Y | - | - | - | - | YWAFLQT |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
2331 | F | - | - | - | - | FLCKQTVW |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
2332 | A | - | - | - | - | PAVGEQRL |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
2333 | S | - | - | - | - | SEIKTALDV |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
2334 | H | - | - | - | - | HNYQFLPGADEIKRSTV |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
2335 | F | - | - | - | - | FYLNWAEGSVDHIKMPQRT |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
2336 | I | - | - | - | - | LMIVQRYADEFGKNPST |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
2337 | S | - | - | - | - | LSGADEIKPRTVCFHMNQY |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
2338 | N | - | - | - | - | NEFVYGSLADIKPQRT |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
2339 | S | - | - | - | - | STLVHNADEFGIKPQRY |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
2340 | W | - | - | - | - | WFSQYADEGIKLNPRTV |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
2341 | L | - | - | - | - | LSAFK |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
2342 | M | - | - | - | - | VMDLSAIFQ |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
2343 | W | - | - | - | - | WRYVHSL |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
2344 | F | - | - | - | - | FLG |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
2345 | I | - | - | - | - | FILYADEGKNPQRSTV |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
2346 | I | - | - | - | - | VILPYFTADEGKRSCHMNQ |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
2347 | S | - | - | - | - | FSHVYNLADEGIKPRTCMQ |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
2348 | I | - | - | - | - | IVLCADEGKPRSTFHMNQY |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
2349 | V | - | - | - | - | VAICGLSDEKNPQRTFHMY |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
2350 | Q | - | - | - | - | NQHRDTLAEFGIKPSVY |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
2351 | M | - | - | - | - | MLFEHADGIKNPQRSTVY |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
2352 | A | - | - | - | - | LVAEIDFGKNPQRSTY |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
2353 | P | - | - | - | - | PSLADEGIKNQRTV |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
2354 | V | - | - | - | - | VFAILM |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
2355 | S | - | - | - | - | SFTDAKLNQH |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
2356 | A | - | - | - | - | VTASG |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
2357 | M | - | - | - | - | LMVEFI |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
2358 | V | - | - | - | - | VFLGCM |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
2359 | R | - | - | - | - | RNVDIST |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
2360 | M | - | - | - | - | MIFHEK |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
2361 | Y | - | - | - | - | YIFVL |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
2362 | I | - | - | - | - | INVL |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
2363 | F | - | - | - | - | FVILS |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
2364 | F | - | - | - | - | FVLMIA |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
2365 | A | - | - | - | - | AFTGV |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
2366 | S | - | - | - | - | ASICKFRT |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
2367 | F | - | - | - | - | FLMGAVC |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
2368 | Y | - | - | - | - | YWFTVIL |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
2369 | Y | - | - | - | - | YLKRFV |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
2370 | I | - | - | - | - | VILFAC |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
2371 | W | - | - | - | - | WLYRVF |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
2372 | K | - | - | - | - | KLCMRGS |
REGION /note="Y1" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y1" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2373 | S | - | - | - | - | FLSGADEIKNPQRTVY |
REGION /note="Y1" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y1" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2374 | Y | - | - | - | - | YFCILVADEGKNPQRST |
REGION /note="Y1" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y1" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2375 | V | - | - | - | - | VRKLNQADEFGIPSTY |
REGION /note="Y1" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y1" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2376 | H | - | - | - | - | H |
BINDING /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_label="5" REGION /note="ZF1" REGION /note="Y1" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" BINDING /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_label="5" REGION /note="ZF1" REGION /note="Y1" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2377 | I | - | - | - | - | VIH |
REGION /note="ZF1" REGION /note="Y1" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="ZF1" REGION /note="Y1" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2378 | M | - | - | - | - | IMVLRCFA |
REGION /note="ZF1" REGION /note="Y1" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="ZF1" REGION /note="Y1" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2379 | D | - | - | - | - | YLFDNV |
REGION /note="ZF1" REGION /note="Y1" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="ZF1" REGION /note="Y1" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2380 | G | - | - | - | - | GYAP |
REGION /note="ZF1" REGION /note="Y1" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="ZF1" REGION /note="Y1" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2381 | C | - | - | - | - | C |
BINDING /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_label="5" REGION /note="ZF1" REGION /note="Y1" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" BINDING /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_label="5" REGION /note="ZF1" REGION /note="Y1" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2382 | T | - | - | - | - | NKSDTE |
REGION /note="ZF1" REGION /note="Y1" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="ZF1" REGION /note="Y1" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2383 | S | - | - | - | - | NKDSR |
REGION /note="ZF1" REGION /note="Y1" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="ZF1" REGION /note="Y1" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2384 | S | - | - | - | - | PVAST |
REGION /note="ZF1" REGION /note="Y1" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="ZF1" REGION /note="Y1" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2385 | T | - | - | - | - | TSGAD |
REGION /note="ZF1" REGION /note="Y1" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="ZF1" REGION /note="Y1" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2386 | C | - | - | - | - | C |
BINDING /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_label="5" REGION /note="ZF1" REGION /note="Y1" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" BINDING /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_label="5" REGION /note="ZF1" REGION /note="Y1" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2387 | M | - | - | - | - | LMEIVK |
REGION /note="ZF1" REGION /note="Y1" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="ZF1" REGION /note="Y1" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2388 | M | - | - | - | - | AMFVLT |
REGION /note="ZF1" REGION /note="Y1" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="ZF1" REGION /note="Y1" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2389 | C | - | - | - | - | C |
BINDING /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_label="5" REGION /note="ZF1" REGION /note="Y1" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" BINDING /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_label="5" REGION /note="ZF1" REGION /note="Y1" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2390 | Y | - | - | - | - | YSK |
REGION /note="Y1" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y1" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2391 | K | - | - | - | - | KR |
REGION /note="Y1" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y1" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2392 | R | - | - | - | - | RSVKIT |
REGION /note="Y1" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y1" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2393 | N | - | - | - | - | NA |
REGION /note="Y1" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y1" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2394 | R | - | - | - | - | RVKC |
REGION /note="Y1" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y1" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2395 | A | - | - | - | - | LSAQ |
REGION /note="Y1" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y1" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2396 | T | - | - | - | - | TKVNL |
REGION /note="Y1" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED REGION /note="Y1" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2397 | R | - | - | - | - | R |
REGION /note="Y1" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED REGION /note="Y1" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2398 | V | - | - | - | - | VIQF |
REGION /note="Y1" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y1" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2399 | E | - | - | - | - | EPK |
REGION /note="Y1" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y1" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2400 | C | - | - | - | - | CVLAI |
REGION /note="Y1" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y1" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2401 | T | - | - | - | - | SQTN |
REGION /note="Y1" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y1" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2402 | T | - | - | - | - | TV |
REGION /note="Y1" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y1" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2403 | I | - | - | - | - | VI |
REGION /note="Y1" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y1" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2404 | V | - | - | - | - | VFIL |
REGION /note="Y1" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y1" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2405 | N | - | - | - | - | NGQC |
REGION /note="Y1" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y1" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2406 | G | - | - | - | - | G |
REGION /note="Y1" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y1" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2407 | M | - | - | - | - | VSMRTG |
REGION /note="Y1" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y1" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2408 | K | - | - | - | - | KMLIHQSTR |
REGION /note="Y1" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y1" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2409 | R | - | - | - | - | RKQ |
REGION /note="Y1" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y1" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2410 | S | - | - | - | - | STYIM |
REGION /note="Y1" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y1" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2411 | F | - | - | - | - | FVY |
REGION /note="Y1" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y1" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2412 | Y | - | - | - | - | YDH |
REGION /note="Y1" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y1" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2413 | V | - | - | - | - | VI |
REGION /note="Y1" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y1" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2414 | Y | - | - | - | - | YNHMTV |
REGION /note="Y1" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y1" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2415 | A | - | - | - | - | AT |
REGION /note="Y1" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y1" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2416 | N | - | - | - | - | N |
REGION /note="Y1" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y1" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2417 | G | - | - | - | - | GS |
REGION /note="Y1" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y1" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2418 | G | - | - | - | - | GT |
REGION /note="Y1" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y1" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2419 | R | - | - | - | - | TYRSGKI |
REGION /note="Y1" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y1" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2420 | G | - | - | - | - | GKNSHC |
REGION /note="Y1" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y1" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2421 | F | - | - | - | - | FL |
REGION /note="Y1" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y1" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2422 | C | - | - | - | - | C |
BINDING /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_label="6" REGION /note="ZF2" REGION /note="Y1" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" BINDING /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_label="6" REGION /note="ZF2" REGION /note="Y1" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2423 | K | - | - | - | - | KTCNRSVA |
REGION /note="ZF2" REGION /note="Y1" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="ZF2" REGION /note="Y1" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2424 | T | - | - | - | - | KRATL |
REGION /note="ZF2" REGION /note="Y1" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="ZF2" REGION /note="Y1" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2425 | H | - | - | - | - | H |
BINDING /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_label="6" REGION /note="ZF2" REGION /note="Y1" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" BINDING /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_label="6" REGION /note="ZF2" REGION /note="Y1" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2426 | N | - | - | - | - | NQR |
REGION /note="ZF2" REGION /note="Y1" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="ZF2" REGION /note="Y1" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2427 | W | - | - | - | - | WF |
REGION /note="ZF2" REGION /note="Y1" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="ZF2" REGION /note="Y1" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2428 | N | - | - | - | - | NFY |
REGION /note="ZF2" REGION /note="Y1" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="ZF2" REGION /note="Y1" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2429 | C | - | - | - | - | C |
BINDING /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_label="6" REGION /note="ZF2" REGION /note="Y1" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" BINDING /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_label="6" REGION /note="ZF2" REGION /note="Y1" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2430 | L | - | - | - | - | VLRKFI |
REGION /note="ZF2" REGION /note="Y1" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="ZF2" REGION /note="Y1" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2431 | N | - | - | - | - | NDS |
REGION /note="ZF2" REGION /note="Y1" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="ZF2" REGION /note="Y1" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2432 | C | - | - | - | - | C |
BINDING /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_label="6" REGION /note="ZF2" REGION /note="Y1" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" BINDING /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_label="6" REGION /note="ZF2" REGION /note="Y1" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2433 | D | - | - | - | - | DNHS |
REGION /note="Y1" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y1" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2434 | T | - | - | - | - | STDA |
REGION /note="Y1" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y1" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2435 | F | - | - | - | - | YFAW |
REGION /note="Y1" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y1" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2436 | C | - | - | - | - | GCKT |
REGION /note="Y1" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y1" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2437 | T | - | - | - | - | PHVAYFIT |
REGION /note="Y1" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y1" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2438 | G | - | - | - | - | GDQE |
REGION /note="Y1" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y1" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2439 | S | - | - | - | - | NSCH |
REGION /note="Y1" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y1" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2440 | T | - | - | - | - | T |
REGION /note="Y1" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y1" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2441 | F | - | - | - | - | F |
REGION /note="Y1" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y1" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2442 | I | - | - | - | - | IM |
REGION /note="Y1" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y1" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2443 | S | - | - | - | - | CSTN |
REGION /note="Y1" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y1" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2444 | D | - | - | - | - | DPEHVRG |
REGION /note="Y1" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y1" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2445 | E | - | - | - | - | EVQD |
REGION /note="Y1" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y1" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2446 | V | - | - | - | - | VIA |
REGION /note="Y1" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y1" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2447 | A | - | - | - | - | AVS |
REGION /note="Y1" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y1" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2448 | R | - | - | - | - | RGLNAPTI |
REGION /note="Y1" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y1" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2449 | D | - | - | - | - | DE |
REGION /note="Y1" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y1" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2450 | L | - | - | - | - | LV |
REGION /note="Y1" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y1" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2451 | S | - | - | - | - | SGT |
REGION /note="Y1" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y1" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2452 | L | - | - | - | - | NKLETA |
REGION /note="Y1" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y1" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2453 | Q | - | - | - | - | QEVSKAI |
REGION /note="Y1" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y1" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2454 | F | - | - | - | - | LFVTI |
REGION /note="Y1" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y1" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2455 | K | - | - | - | - | KR |
REGION /note="Y1" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y1" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2456 | R | - | - | - | - | RLTQ |
REGION /note="Y1" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y1" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2457 | P | - | - | - | - | PNHTAL |
REGION /note="Y1" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y1" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2458 | I | - | - | - | - | VI |
REGION /note="Y1" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y1" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2459 | N | - | - | - | - | NQKIY |
REGION /note="Y1" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y1" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2460 | P | - | - | - | - | PAH |
REGION /note="Y1" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y1" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2461 | T | - | - | - | - | T |
REGION /note="Y1" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y1" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2462 | D | - | - | - | - | DAG |
REGION /note="Y1" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y1" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2463 | Q | - | - | - | - | PRQYSEKAV |
REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2464 | S | - | - | - | - | AS |
REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2465 | S | - | - | - | - | YHSTA |
REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2466 | Y | - | - | - | - | YHIVQ |
REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2467 | I | - | - | - | - | VEIYLSMT |
REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2468 | V | - | - | - | - | VI |
REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2469 | D | - | - | - | - | DTEYI |
REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2470 | S | - | - | - | - | KSED |
REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2471 | V | - | - | - | - | VAI |
REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2472 | A | - | - | - | - | EKTCAD |
REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2473 | V | - | - | - | - | VFQCL |
REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2474 | K | - | - | - | - | VKSRET |
REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2475 | N | - | - | - | - | NDGE |
REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2476 | G | - | - | - | - | GCDST |
REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2477 | A | - | - | - | - | FSAVYM |
REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2478 | L | - | - | - | - | YVMLI |
REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2479 | H | - | - | - | - | RYHNQ |
REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2480 | L | - | - | - | - | LFC |
REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2481 | Y | - | - | - | - | YFKHN |
REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2482 | F | - | - | - | - | YFS |
REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2483 | D | - | - | - | - | DEKGRS |
REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2484 | K | - | - | - | - | RKASIVD |
REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2485 | A | - | - | - | - | DATKE |
REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2486 | G | - | - | - | - | GEFHPT |
REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2487 | Q | - | - | - | - | QSWKAGP |
REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2488 | K | - | - | - | - | KRPS |
REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2489 | T | - | - | - | - | YTVDSCF |
REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2490 | Y | - | - | - | - | YSN |
REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2491 | E | - | - | - | - | EDACFS |
REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2492 | R | - | - | - | - | RDSKQ |
REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2493 | H | - | - | - | - | EVHFSIY |
REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2494 | P | - | - | - | - | PVATSND |
REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2495 | L | - | - | - | - | LAVMDEF |
REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2496 | S | - | - | - | - | SKCDA |
REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2497 | H | - | - | - | - | LHACKNSTY |
REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2498 | F | - | - | - | - | FCYM |
REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2499 | V | - | - | - | - | VTSNAFL |
REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2500 | N | - | - | - | - | NVDCL |
REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2501 | L | - | - | - | - | LTKMVIY |
REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2502 | D | - | - | - | - | DNES |
REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2503 | N | - | - | - | - | NKDFGAV |
REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2504 | L | - | - | - | - | LF |
REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2505 | R | - | - | - | - | KILRH |
REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2506 | A | - | - | - | - | AVHYCFNL |
REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2507 | N | - | - | - | - | SYNVKCFL |
REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2508 | N | - | - | - | - | NKFESTL |
REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2509 | T | - | - | - | - | TLVNPADEGIKRS |
REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2510 | K | - | - | - | - | KSNPTL |
REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2511 | G | - | - | - | - | GECTVL |
REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2512 | S | - | - | - | - | SAVTGIL |
REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2513 | L | - | - | - | - | LPIASDEGKNQRTV |
REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2514 | P | - | - | - | - | PLEKNIADGQRSTV |
REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2515 | I | - | - | - | - | TICAFHLYMDEGKNPQRSV |
REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2516 | N | - | - | - | - | NHEDSYAGIKLPQRTV |
REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2517 | V | - | - | - | - | VFQADEGIKLNPRST |
REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2518 | I | - | - | - | - | IVLAGSDEFHKMNPQRTY |
REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2519 | V | - | - | - | - | VSIAGLDEFHKMNPQRTY |
REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2520 | F | - | - | - | - | FVNYLAEGKSTCDHIMPQR |
REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2521 | D | - | - | - | - | DENLAGKSTVCFHIMPQRY |
REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2522 | G | - | - | - | - | GNSAVLDEIKPTCFHMQRY |
REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2523 | K | - | - | - | - | KEFNSTDAGLVHIMPQRY |
REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2524 | S | - | - | - | - | SAIDNGLVEFHKMPQRTY |
REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2525 | K | - | - | - | - | RKVGSDALEINPQTCFHMWY |
REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2526 | C | - | - | - | - | CGISALETVDFKNPQRHMWY |
REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2527 | D | - | - | - | - | NDEQAGIKLPRSTV |
REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2528 | E | - | - | - | - | EVKTIRADGLNPS |
REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2529 | S | - | - | - | - | SANTQDEGIKLPRV |
REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2530 | A | - | - | - | - | QASLGNDEIKPRTV |
REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2531 | S | - | - | - | - | AVFISDEGKLNPRT |
REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2532 | K | - | - | - | - | KRL |
REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2533 | S | - | - | - | - | NSTG |
REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2534 | A | - | - | - | - | AV |
REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2535 | S | - | - | - | - | CASV |
REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2536 | V | - | - | - | - | VI |
REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2537 | Y | - | - | - | - | YF |
REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2538 | Y | - | - | - | - | YF |
REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2539 | S | - | - | - | - | SA |
REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2540 | Q | - | - | - | - | Q |
REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2541 | L | - | - | - | - | LSYVM |
REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2542 | M | - | - | - | - | LMIA |
REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2543 | C | - | - | - | - | CYGSF |
REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2544 | Q | - | - | - | - | KRQE |
REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2545 | P | - | - | - | - | PS |
REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2546 | I | - | - | - | - | IMV |
REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2547 | L | - | - | - | - | LK |
REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2548 | L | - | - | - | - | LIM |
REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2549 | L | - | - | - | - | VL |
REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2550 | D | - | - | - | - | DNE |
REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2551 | Q | - | - | - | - | SQK |
REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2552 | A | - | - | - | - | AEKNRDS |
REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2553 | L | - | - | - | - | LM |
REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2554 | V | - | - | - | - | LVIY |
REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2555 | S | - | - | - | - | TSEAG |
REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2556 | D | - | - | - | - | TDSQV |
REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2557 | V | - | - | - | - | LVA |
REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y2" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2558 | G | - | - | - | - | GNVCLAESDFIKPQRTHMWY |
REGION /note="Y3" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y3" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2559 | D | - | - | - | - | DTINLAEGSVFKPQRCHMWY |
REGION /note="Y3" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y3" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2560 | S | - | - | - | - | SGVDN |
REGION /note="Y3" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y3" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2561 | T | - | - | - | - | VTEALRSI |
REGION /note="Y3" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y3" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2562 | E | - | - | - | - | DESPT |
REGION /note="Y3" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y3" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2563 | V | - | - | - | - | VFI |
REGION /note="Y3" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y3" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2564 | S | - | - | - | - | SANKTG |
REGION /note="Y3" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y3" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2565 | V | - | - | - | - | GVRKAQSTE |
REGION /note="Y3" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y3" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2566 | K | - | - | - | - | KSTAVN |
REGION /note="Y3" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y3" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2567 | M | - | - | - | - | MLV |
REGION /note="Y3" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y3" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2568 | F | - | - | - | - | FHIL |
REGION /note="Y3" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y3" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2569 | D | - | - | - | - | DKNES |
REGION /note="Y3" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y3" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2570 | A | - | - | - | - | AKSLV |
REGION /note="Y3" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y3" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2571 | Y | - | - | - | - | YFVK |
REGION /note="Y3" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y3" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2572 | V | - | - | - | - | VCKAI |
REGION /note="Y3" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y3" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2573 | D | - | - | - | - | DNSQEY |
REGION /note="Y3" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y3" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2574 | T | - | - | - | - | VTSIN |
REGION /note="Y3" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y3" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2575 | F | - | - | - | - | LFIY |
REGION /note="Y3" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y3" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2576 | S | - | - | - | - | SLKCIRVM |
REGION /note="Y3" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y3" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2577 | A | - | - | - | - | NSALGR |
REGION /note="Y3" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y3" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2578 | T | - | - | - | - | STILHKVM |
REGION /note="Y3" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y3" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2579 | F | - | - | - | - | FIYL |
REGION /note="Y3" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y3" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2580 | S | - | - | - | - | SGNDL |
REGION /note="Y3" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y3" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2581 | V | - | - | - | - | VKIADEGLNPQRST |
REGION /note="Y3" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y3" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2582 | P | - | - | - | - | DPANTEGIKLQRSV |
REGION /note="Y3" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y3" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2583 | M | - | - | - | - | RMLVFKADEGINPQSTY |
REGION /note="Y3" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y3" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2584 | E | - | - | - | - | KSDEAGILNPQRTV |
REGION /note="Y3" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y3" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2585 | K | - | - | - | - | KSEDNAGILPQRTV |
REGION /note="Y3" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y3" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2586 | L | - | - | - | - | LCVFADEGIKNPQRST |
REGION /note="Y3" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y3" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2587 | K | - | - | - | - | KNTSDEAGILPQRV |
REGION /note="Y3" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y3" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2588 | A | - | - | - | - | ANKSHDTEGILPQRV |
REGION /note="Y3" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y3" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2589 | L | - | - | - | - | LFNMADEGIKPQRSTV |
REGION /note="Y3" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y3" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2590 | V | - | - | - | - | VMIYAGLSDEKNPQRTCFH |
REGION /note="Y3" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y3" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2591 | A | - | - | - | - | ASNGLDEIKPQRTVCFHMY |
REGION /note="Y3" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y3" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2592 | T | - | - | - | - | TALIMGSDEFHKNPQRVY |
REGION /note="Y3" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED REGION /note="Y3" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2593 | A | - | - | - | - | AGLSDEFHIKMNPQRTVY |
REGION /note="Y3" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y3" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2594 | H | - | - | - | - | HEARLGSDFIKMNPQTVY |
REGION /note="Y3" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED REGION /note="Y3" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2595 | S | - | - | - | - | DSLQCNAE |
REGION /note="Y3" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED REGION /note="Y3" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2596 | E | - | - | - | - | ESNKQCDGL |
REGION /note="Y3" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED REGION /note="Y3" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2597 | L | - | - | - | - | LCYVIAR |
REGION /note="Y3" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y3" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2598 | A | - | - | - | - | KAYRSTL |
REGION /note="Y3" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED REGION /note="Y3" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2599 | K | - | - | - | - | KREALSQ |
REGION /note="Y3" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED REGION /note="Y3" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2600 | G | - | - | - | - | GALTN |
REGION /note="Y3" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y3" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2601 | V | - | - | - | - | VLTDCM |
REGION /note="Y3" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y3" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2602 | A | - | - | - | - | QNLTASDG |
REGION /note="Y3" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y3" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2603 | L | - | - | - | - | LFRIVADEGKNPQST |
REGION /note="Y3" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y3" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2604 | D | - | - | - | - | DESHNQCAGIKLPRTV |
REGION /note="Y3" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y3" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2605 | G | - | - | - | - | ADGSVQKTNEILPR |
REGION /note="Y3" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y3" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2606 | V | - | - | - | - | VLSTADEFGIKNPQRY |
REGION /note="Y3" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED REGION /note="Y3" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2607 | L | - | - | - | - | LFMIADEGKNPQRSTVY |
REGION /note="Y3" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED REGION /note="Y3" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2608 | S | - | - | - | - | SDKHTAEGILNPQRV |
REGION /note="Y3" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y3" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2609 | T | - | - | - | - | TIVEADGKLNPQRS |
REGION /note="Y3" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y3" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2610 | F | - | - | - | - | FAEGLSVDHIKMNPQRTY |
REGION /note="Y3" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED REGION /note="Y3" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2611 | V | - | - | - | - | VIETNLAGSDFHKMPQRY |
REGION /note="Y3" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED REGION /note="Y3" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2612 | S | - | - | - | - | SGDMANLEFIKPQRTVY |
REGION /note="Y3" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED REGION /note="Y3" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2613 | A | - | - | - | - | ACSELDFGIKNPQRTVY |
REGION /note="Y3" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED REGION /note="Y3" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2614 | A | - | - | - | - | AVITCSLDEFGKNPQRY |
REGION /note="Y3" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED REGION /note="Y3" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2615 | R | - | - | - | - | RNSALDEFGIKPQTVY |
REGION /note="Y3" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED REGION /note="Y3" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2616 | Q | - | - | - | - | NQEGRKALDFIPSTVY |
REGION /note="Y3" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED REGION /note="Y3" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2617 | G | - | - | - | - | GKPSECLAVDFINQRTHMWY |
REGION /note="Y3" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED REGION /note="Y3" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2618 | V | - | - | - | - | AVLCFEGSDIKNPQRTHMWY |
REGION /note="Y3" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED REGION /note="Y3" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2619 | V | - | - | - | - | VIGKLAESDFNPQRTCHMWY |
REGION /note="Y3" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED REGION /note="Y3" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2620 | D | - | - | - | - | DELAGSVFIKNPQRTCHMWY |
REGION /note="Y3" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED REGION /note="Y3" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2621 | T | - | - | - | - | STLAEGVDFIKNPQRCHMWY |
REGION /note="Y3" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED REGION /note="Y3" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2622 | D | - | - | - | - | DLAEGSVFIKNPQRTCHMWY |
REGION /note="Y3" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED REGION /note="Y3" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2623 | V | - | - | - | - | VAGLSDEIKNPQRTCFHMY |
REGION /note="Y3" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED REGION /note="Y3" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2624 | D | - | - | - | - | EDSPAGLIKNQRTVCFHMY |
REGION /note="Y3" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED REGION /note="Y3" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2625 | T | - | - | - | - | TDEAGLSFHIKMNPQRVY |
REGION /note="Y3" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED REGION /note="Y3" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2626 | K | - | - | - | - | KNDESRAGLFHIMPQTVY |
REGION /note="Y3" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED REGION /note="Y3" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2627 | D | - | - | - | - | DSECFAGLHIKMNPQRTVY |
REGION /note="Y3" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED REGION /note="Y3" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2628 | V | - | - | - | - | IVAFLGSDEHKMNPQRTY |
REGION /note="Y3" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED REGION /note="Y3" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2629 | I | - | - | - | - | VTISAGLDEFHKMNPQRY |
REGION /note="Y3" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED REGION /note="Y3" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2630 | E | - | - | - | - | DEKSAGLFHIMNPQRTVY |
REGION /note="Y3" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y3" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2631 | C | - | - | - | - | SCAMGLDEFHIKNPQRTVY |
REGION /note="Y3" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED REGION /note="Y3" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2632 | L | - | - | - | - | VLAIMGSDEFHKNPQRTY |
REGION /note="Y3" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y3" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2633 | K | - | - | - | - | IKMQARSGLDEFHNPTVY |
REGION /note="Y3" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y3" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2634 | L | - | - | - | - | LSFYENAGDHIKMPQRTV |
REGION /note="Y3" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y3" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2635 | S | - | - | - | - | ACS |
REGION /note="Y3" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y3" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2636 | H | - | - | - | - | HVY |
REGION /note="Y3" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y3" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2637 | H | - | - | - | - | RNHKQAS |
REGION /note="Y3" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y3" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2638 | S | - | - | - | - | HAYSFEC |
REGION /note="Y3" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y3" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2639 | D | - | - | - | - | DGE |
REGION /note="Y3" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y3" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2640 | L | - | - | - | - | VILW |
REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2641 | E | - | - | - | - | ELDQ |
REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2642 | V | - | - | - | - | LIVYFW |
REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2643 | T | - | - | - | - | TS |
REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2644 | G | - | - | - | - | DGTN |
REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2645 | D | - | - | - | - | DELRMV |
REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2646 | S | - | - | - | - | SGN |
REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2647 | C | - | - | - | - | FCYW |
REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2648 | N | - | - | - | - | NT |
REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2649 | N | - | - | - | - | N |
REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2650 | F | - | - | - | - | FLYV |
REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2651 | M | - | - | - | - | VIMWFT |
REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2652 | L | - | - | - | - | PLISTV |
REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2653 | T | - | - | - | - | ST |
REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2654 | Y | - | - | - | - | YK |
REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2655 | N | - | - | - | - | AVINGL |
REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2656 | K | - | - | - | - | KD |
REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2657 | V | - | - | - | - | PSVTQG |
REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2658 | E | - | - | - | - | DESG |
REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2659 | N | - | - | - | - | KNTGSDE |
REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2660 | M | - | - | - | - | LVIMK |
REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2661 | T | - | - | - | - | STVAF |
REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2662 | P | - | - | - | - | APTV |
REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2663 | R | - | - | - | - | RAHYMLS |
REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2664 | D | - | - | - | - | DE |
REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2665 | L | - | - | - | - | LIRV |
REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2666 | G | - | - | - | - | GA |
REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2667 | A | - | - | - | - | VCAFKQNST |
REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2668 | C | - | - | - | - | CLF |
REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2669 | I | - | - | - | - | IM |
REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2670 | D | - | - | - | - | DRQTN |
REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2671 | C | - | - | - | - | ACNVFLS |
REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2672 | N | - | - | - | - | NGDS |
REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2673 | A | - | - | - | - | AS |
REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2674 | R | - | - | - | - | KRSA |
REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2675 | H | - | - | - | - | HIVSY |
REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2676 | I | - | - | - | - | VIA |
REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2677 | N | - | - | - | - | NQ |
REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2678 | A | - | - | - | - | AHLQGS |
REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2679 | Q | - | - | - | - | NQRKIT |
REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2680 | V | - | - | - | - | VIS |
REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2681 | A | - | - | - | - | ALKI |
REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2682 | K | - | - | - | - | KTRNIV |
REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2683 | S | - | - | - | - | AKSNQGI |
REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2684 | H | - | - | - | - | ADHPRES |
REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2685 | N | - | - | - | - | NGPSAQ |
REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2686 | V | - | - | - | - | VIGKT |
REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2687 | S | - | - | - | - | SAPNDEGIKLQRTV |
REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2688 | L | - | - | - | - | CVLIADEGKNPQRST |
REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2689 | I | - | - | - | - | VI |
REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2690 | W | - | - | - | - | W |
REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2691 | N | - | - | - | - | NLSKRGHF |
REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2692 | V | - | - | - | - | VASFYI |
REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2693 | K | - | - | - | - | KDSAQR |
REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2694 | D | - | - | - | - | DAET |
REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2695 | Y | - | - | - | - | FYL |
REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2696 | M | - | - | - | - | INMAS |
REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2697 | S | - | - | - | - | KSQAT |
REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2698 | L | - | - | - | - | L |
REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2699 | S | - | - | - | - | ST |
REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2700 | E | - | - | - | - | EDASQ |
REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2701 | Q | - | - | - | - | SEDQTA |
REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2702 | L | - | - | - | - | LACGMTF |
REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2703 | R | - | - | - | - | RQKL |
REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2704 | K | - | - | - | - | KHR |
REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2705 | Q | - | - | - | - | YQVRK |
REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2706 | I | - | - | - | - | LI |
REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2707 | R | - | - | - | - | RVIK |
REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2708 | S | - | - | - | - | KSRIV |
REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2709 | A | - | - | - | - | AT |
REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2710 | A | - | - | - | - | CTAFS |
REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2711 | K | - | - | - | - | KVRSC |
REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2712 | K | - | - | - | - | KAETV |
REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2713 | N | - | - | - | - | TKNSCE |
REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2714 | N | - | - | - | - | GN |
REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2715 | I | - | - | - | - | LIVG |
REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2716 | P | - | - | - | - | NPKTRA |
REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2717 | F | - | - | - | - | FLI |
REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2718 | R | - | - | - | - | RKLFMS |
REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2719 | L | - | - | - | - | LIV |
REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2720 | T | - | - | - | - | T |
REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2721 | C | - | - | - | - | FTCYKI |
REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2722 | A | - | - | - | - | NSA |
REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2723 | T | - | - | - | - | KDTGASER |
REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2724 | T | - | - | - | - | QLTANVCR |
REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2725 | R | - | - | - | - | RKEQGM |
REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2726 | Q | - | - | - | - | AQSM |
REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2727 | V | - | - | - | - | VNDHAIS |
REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2728 | V | - | - | - | - | VTDIEL |
REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2729 | N | - | - | - | - | NPQTDSA |
REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2730 | V | - | - | - | - | IVCLA |
REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2731 | I | - | - | - | - | LPHIFMV |
REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2732 | T | - | - | - | - | TASV |
REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2733 | T | - | - | - | - | TVQEI |
REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2734 | K | - | - | - | - | KSPCR |
REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2735 | I | - | - | - | - | FIVL |
REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2736 | S | - | - | - | - | SALVKT |
REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2737 | L | - | - | - | - | LAVNIP |
REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2738 | K | - | - | - | - | KISL |
REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2739 | G | - | - | - | - | GAKSQ |
REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2740 | G | - | - | - | - | GN |
SITE /note="Cleavage; by PL-PRO" REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" SITE /note="Cleavage; by PL-PRO" REGION /note="Y4" REGION /note="CoV-Y" DOMAIN /note="CoV Nsp3 Y" TOPO_DOM /note="Cytoplasmic" | ||
2741 | K | - | - | - | - | AKGSRDV |
SITE /note="Cleavage; by PL-PRO" TOPO_DOM /note="Cytoplasmic" SITE /note="Cleavage; by PL-PRO" TOPO_DOM /note="Cytoplasmic" | ||
2742 | I | - | - | - | - | IGVAL |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
2743 | V | - | - | - | - | VFLGIR |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
2744 | S | - | - | - | - | SPFNDGHK |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
2745 | T | - | - | - | - | SRTDKNWFGY |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
2746 | C | - | - | - | - | VLCTWRAFM |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
2747 | F | - | - | - | - | FLRISTWY |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
2748 | K | - | - | - | - | KTQVNWY |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
2749 | L | - | - | - | - | LWSQIFGRVADEKPT |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
2750 | M | - | - | - | - | LYMIKQW |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
2751 | L | - | - | - | - | FLKHCVWYI |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
2752 | K | - | - | - | - | VKLFQYADEGIPRST |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
2753 | A | - | - | - | - | FAVICQWL |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
2754 | T | - | - | - | - | TLNSVMCGWY |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
2755 | L | - | - | - | - | LIFY |
TRANSMEM /note="Helical" REGION /note="HD2" TRANSMEM /note="Helical" REGION /note="HD2" | ||
2756 | L | - | - | - | - | LIVFW |
TRANSMEM /note="Helical" REGION /note="HD2" TRANSMEM /note="Helical" REGION /note="HD2" | ||
2757 | C | - | - | - | - | CVFWL |
TRANSMEM /note="Helical" REGION /note="HD2" TRANSMEM /note="Helical" REGION /note="HD2" | ||
2758 | V | - | - | - | - | FVLHY |
TRANSMEM /note="Helical" REGION /note="HD2" TRANSMEM /note="Helical" REGION /note="HD2" | ||
2759 | L | - | - | - | - | LIAVTF |
TRANSMEM /note="Helical" REGION /note="HD2" TRANSMEM /note="Helical" REGION /note="HD2" | ||
2760 | A | - | - | - | - | LACNQFMVGDEIKPRSTY |
TRANSMEM /note="Helical" REGION /note="HD2" TRANSMEM /note="Helical" REGION /note="HD2" | ||
2761 | A | - | - | - | - | AFPCIVSGLDEKNQRTY |
TRANSMEM /note="Helical" REGION /note="HD2" TRANSMEM /note="Helical" REGION /note="HD2" | ||
2762 | L | - | - | - | - | LTIVCYFAGDEKNPQRS |
TRANSMEM /note="Helical" REGION /note="HD2" TRANSMEM /note="Helical" REGION /note="HD2" | ||
2763 | V | - | - | - | - | LVIAPFGT |
TRANSMEM /note="Helical" REGION /note="HD2" TRANSMEM /note="Helical" REGION /note="HD2" | ||
2764 | C | - | - | - | - | CLVGWMSF |
TRANSMEM /note="Helical" REGION /note="HD2" TRANSMEM /note="Helical" REGION /note="HD2" | ||
2765 | Y | - | - | - | - | YFWSV |
TRANSMEM /note="Helical" REGION /note="HD2" TRANSMEM /note="Helical" REGION /note="HD2" | ||
2766 | I | - | - | - | - | ILAYFGSV |
TRANSMEM /note="Helical" REGION /note="HD2" TRANSMEM /note="Helical" REGION /note="HD2" | ||
2767 | V | - | - | - | - | LVIYCMF |
TRANSMEM /note="Helical" REGION /note="HD2" TRANSMEM /note="Helical" REGION /note="HD2" | ||
2768 | M | - | - | - | - | MLARCDVT |
TRANSMEM /note="Helical" REGION /note="HD2" TRANSMEM /note="Helical" REGION /note="HD2" | ||
2769 | P | - | - | - | - | PEASTY |
TRANSMEM /note="Helical" REGION /note="HD2" TRANSMEM /note="Helical" REGION /note="HD2" | ||
2770 | V | - | - | - | - | TVIAFMQY |
TRANSMEM /note="Helical" REGION /note="HD2" TRANSMEM /note="Helical" REGION /note="HD2" | ||
2771 | H | - | - | - | - | YFSHENT |
TRANSMEM /note="Helical" REGION /note="HD2" TRANSMEM /note="Helical" REGION /note="HD2" | ||
2772 | T | - | - | - | - | SAKTYLMNIV |
TRANSMEM /note="Helical" REGION /note="HD2" TRANSMEM /note="Helical" REGION /note="HD2" | ||
2773 | L | - | - | - | - | VLMSIYAG |
TRANSMEM /note="Helical" REGION /note="HD2" TRANSMEM /note="Helical" REGION /note="HD2" | ||
2774 | S | - | - | - | - | SHFDAETVYGL |
TRANSMEM /note="Helical" REGION /note="HD2" TRANSMEM /note="Helical" REGION /note="HD2" | ||
2775 | I | - | - | - | - | KVFSIPQTAGL |
TRANSMEM /note="Helical" REGION /note="HD2" TRANSMEM /note="Helical" REGION /note="HD2" | ||
2776 | H | - | - | - | - | HSVAFLQG |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2777 | D | - | - | - | - | DPSEAHGTIKLNQRV |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2778 | G | - | - | - | - | GMFSQIDAL |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2779 | Y | - | - | - | - | YQFHSVAGL |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2780 | T | - | - | - | - | TLDEISAFGKNPQRV |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2781 | N | - | - | - | - | DPLNSAEGVFHIKMQRTY |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2782 | E | - | - | - | - | EHRSLDNAVGIKPT |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2783 | I | - | - | - | - | IVYGTADEKLNPRS |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2784 | I | - | - | - | - | EYIALVTDGKNPRS |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2785 | G | - | - | - | - | GDSTAEIKLNPRV |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2786 | Y | - | - | - | - | FY |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2787 | K | - | - | - | - | KDM |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2788 | A | - | - | - | - | VYA |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2789 | I | - | - | - | - | ILV |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2790 | Q | - | - | - | - | DEQK |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2791 | D | - | - | - | - | NKDSG |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2792 | G | - | - | - | - | GA |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2793 | V | - | - | - | - | VQI |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2794 | T | - | - | - | - | LIVT |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2795 | R | - | - | - | - | RKQ |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2796 | D | - | - | - | - | DEVNPST |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2797 | I | - | - | - | - | IFV |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2798 | I | - | - | - | - | VEDTSNAIM |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2799 | S | - | - | - | - | SVPADKN |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2800 | T | - | - | - | - | TPESADN |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2801 | D | - | - | - | - | DLI |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2802 | D | - | - | - | - | DTKNSAQHLV |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2803 | C | - | - | - | - | C |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2804 | F | - | - | - | - | FV |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2805 | A | - | - | - | - | AHSR |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2806 | N | - | - | - | - | N |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2807 | K | - | - | - | - | KVTA |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2808 | H | - | - | - | - | FHY |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2809 | A | - | - | - | - | VAKEINSDQRF |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2810 | G | - | - | - | - | NGQSAD |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2811 | F | - | - | - | - | F |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2812 | D | - | - | - | - | DENAGST |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2813 | A | - | - | - | - | QADSNEKVT |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2814 | W | - | - | - | - | WF |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2815 | F | - | - | - | - | YFHW |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2816 | S | - | - | - | - | ESKNADHGILPQRTV |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2817 | Q | - | - | - | - | ASQENKDGILPRTV |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2818 | R | - | - | - | - | KRTHFADEGILNPQSV |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2819 | G | - | - | - | - | GFYH |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2820 | G | - | - | - | - | GFKR |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2821 | S | - | - | - | - | SYTVFLP |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2822 | Y | - | - | - | - | YIPVF |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2823 | K | - | - | - | - | RTVDPEKLNHS |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2824 | N | - | - | - | - | NT |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2825 | D | - | - | - | - | SDNGK |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2826 | K | - | - | - | - | KRIMDPQ |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2827 | S | - | - | - | - | SANGKRTD |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2828 | C | - | - | - | - | C |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2829 | P | - | - | - | - | P |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2830 | V | - | - | - | - | IVLM |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2831 | V | - | - | - | - | VTI |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2832 | A | - | - | - | - | VATGL |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2833 | A | - | - | - | - | AGTV |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2834 | I | - | - | - | - | VIT |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2835 | I | - | - | - | - | IVSFMLADEGKNPQRTY |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2836 | T | - | - | - | - | DTSAEFGIKLNPQRV |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2837 | R | - | - | - | - | GRQDSLE |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2838 | E | - | - | - | - | DEIV |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2839 | I | - | - | - | - | IVANLEDGKPQRST |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2840 | G | - | - | - | - | GVAMRL |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2841 | F | - | - | - | - | SFTANRYHL |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2842 | I | - | - | - | - | TVIRLMP |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2843 | V | - | - | - | - | VIALM |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2844 | P | - | - | - | - | PFATV |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2845 | G | - | - | - | - | GND |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2846 | L | - | - | - | - | VLI |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2847 | P | - | - | - | - | P |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2848 | G | - | - | - | - | AGTSL |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2849 | T | - | - | - | - | TNKFGYR |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2850 | V | - | - | - | - | VFTI |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2851 | L | - | - | - | - | LYSFADEGIKNPQRTV |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2852 | R | - | - | - | - | RAWLDEGIKPSTVCFHMNQY |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2853 | A | - | - | - | - | AVWSTHLGDEFIKNPQRCMY |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2854 | I | - | - | - | - | LVIYMTADEGKPRS |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2855 | N | - | - | - | - | GVNDYL |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2856 | G | - | - | - | - | GFTNRY |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2857 | D | - | - | - | - | KHDMQRT |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2858 | F | - | - | - | - | FVTSIL |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2859 | L | - | - | - | - | LIV |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2860 | H | - | - | - | - | HVIPFL |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2861 | F | - | - | - | - | FYL |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2862 | L | - | - | - | - | IALVT |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2863 | P | - | - | - | - | PTILSNM |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2864 | R | - | - | - | - | RNHTQYS |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2865 | V | - | - | - | - | AVWTGL |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2866 | F | - | - | - | - | FAIL |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2867 | S | - | - | - | - | AFSNG |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2868 | A | - | - | - | - | AGISTN |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2869 | V | - | - | - | - | VDTFNS |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2870 | G | - | - | - | - | GSTANR |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2871 | N | - | - | - | - | NVGSADEIKLPQRT |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2872 | I | - | - | - | - | VQILMADEGKNPRST |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2873 | C | - | - | - | - | CADEGIKLNPQRSTV |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2874 | Y | - | - | - | - | YF |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2875 | T | - | - | - | - | TDL |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2876 | P | - | - | - | - | PQADGHL |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2877 | S | - | - | - | - | HSDTEAIRL |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2878 | K | - | - | - | - | KGSAMYDIL |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2879 | L | - | - | - | - | LQIEVANDGKPRST |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2880 | I | - | - | - | - | IATSDEGKLNPQRV |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2881 | E | - | - | - | - | PDETSNKVL |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2882 | Y | - | - | - | - | YEFSNLADGIKPQRTV |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2883 | S | - | - | - | - | DSGKENTLAFIPQRVY |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2884 | D | - | - | - | - | DSNVGRYLAEFIKPQT |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2885 | F | - | - | - | - | FSVLADEGIKNPQRTY |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2886 | A | - | - | - | - | YSADTLEFGIKNPQRV |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2887 | T | - | - | - | - | TADFKPL |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2888 | S | - | - | - | - | SDGAEIKLNPRTV |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2889 | A | - | - | - | - | GAIKSTDELNPRV |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2890 | C | - | - | - | - | CA |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2891 | V | - | - | - | - | VIL |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2892 | L | - | - | - | - | LF |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2893 | A | - | - | - | - | SNAPT |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2894 | A | - | - | - | - | SAT |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2895 | E | - | - | - | - | AELRT |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2896 | C | - | - | - | - | C |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2897 | T | - | - | - | - | TADEGIKLNPQRSV |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2898 | I | - | - | - | - | LMTIR |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2899 | F | - | - | - | - | LFY |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2900 | K | - | - | - | - | KSALERT |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2901 | D | - | - | - | - | DGTHSMRLAEFIKNPQVY |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2902 | A | - | - | - | - | AGLI |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2903 | M | - | - | - | - | SDGMELI |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2904 | G | - | - | - | - | GN |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2905 | K | - | - | - | - | TKGREDNS |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2906 | P | - | - | - | - | PNTRIM |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2907 | V | - | - | - | - | VQHMAINT |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2908 | P | - | - | - | - | PVLADEFGIKNQRSTY |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2909 | Y | - | - | - | - | Y |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2910 | C | - | - | - | - | C |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2911 | Y | - | - | - | - | YAFH |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2912 | D | - | - | - | - | DNKTRS |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2913 | T | - | - | - | - | TDEPQANG |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2914 | N | - | - | - | - | GNATD |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2915 | L | - | - | - | - | LVDI |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2916 | L | - | - | - | - | LMVAI |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2917 | E | - | - | - | - | EPQHDK |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2918 | G | - | - | - | - | GN |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2919 | S | - | - | - | - | AS |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2920 | I | - | - | - | - | SKLIFV |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2921 | S | - | - | - | - | LPASR |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2922 | Y | - | - | - | - | YF |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2923 | S | - | - | - | - | SDGTE |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2924 | E | - | - | - | - | SEQMDT |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2925 | L | - | - | - | - | LIM |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2926 | R | - | - | - | - | RAIKQVLM |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2927 | P | - | - | - | - | PA |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2928 | D | - | - | - | - | HDN |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2929 | T | - | - | - | - | VTRASY |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2930 | R | - | - | - | - | RYVM |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2931 | Y | - | - | - | - | Y |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2932 | V | - | - | - | - | KVNFDEPRS |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2933 | L | - | - | - | - | LQYHMF |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2934 | M | - | - | - | - | AMYPDV |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2935 | D | - | - | - | - | DNSEA |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2936 | G | - | - | - | - | GSHKA |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2937 | S | - | - | - | - | NSVDG |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2938 | I | - | - | - | - | YMFIRAH |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2939 | I | - | - | - | - | IVL |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2940 | Q | - | - | - | - | RKQISV |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2941 | F | - | - | - | - | FLVI |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2942 | P | - | - | - | - | P |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2943 | N | - | - | - | - | ENQAD |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2944 | T | - | - | - | - | VIQTA |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2945 | Y | - | - | - | - | IVYLAG |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2946 | L | - | - | - | - | LSRAFIT |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2947 | E | - | - | - | - | ERHSGQ |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2948 | G | - | - | - | - | GSALFDEIKNPQRTV |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2949 | S | - | - | - | - | GTISL |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2950 | V | - | - | - | - | VLPIF |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2951 | R | - | - | - | - | RYH |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2952 | V | - | - | - | - | IVTF |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2953 | V | - | - | - | - | VIT |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2954 | T | - | - | - | - | RKT |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2955 | T | - | - | - | - | TF |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2956 | F | - | - | - | - | RLQFVMIK |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2957 | D | - | - | - | - | ASD |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2958 | A | - | - | - | - | MTDAS |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2959 | E | - | - | - | - | TESRKQ |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2960 | Y | - | - | - | - | Y |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2961 | C | - | - | - | - | C |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2962 | R | - | - | - | - | RK |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2963 | H | - | - | - | - | VHGFT |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2964 | G | - | - | - | - | GS |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2965 | T | - | - | - | - | ETLVSRQA |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2966 | C | - | - | - | - | C |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2967 | E | - | - | - | - | EIVDRT |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2968 | R | - | - | - | - | DEYRVQ |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2969 | S | - | - | - | - | SAT |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2970 | E | - | - | - | - | EQKNAHRD |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2971 | V | - | - | - | - | AEPKV |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2972 | G | - | - | - | - | G |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2973 | I | - | - | - | - | VIYFL |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2974 | C | - | - | - | - | C |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2975 | L | - | - | - | - | FVLIM |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2976 | S | - | - | - | - | GSNT |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2977 | T | - | - | - | - | FTLGA |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2978 | S | - | - | - | - | DNSQ |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2979 | G | - | - | - | - | GSRPNADEIKLQTV |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2980 | R | - | - | - | - | SRQFKW |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2981 | W | - | - | - | - | WF |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2982 | V | - | - | - | - | VAFY |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2983 | L | - | - | - | - | LYVI |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2984 | N | - | - | - | - | NFDSY |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2985 | N | - | - | - | - | NDKA |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2986 | E | - | - | - | - | DEGPAT |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2987 | H | - | - | - | - | YHEFAGLSVDIKMNPQRT |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2988 | Y | - | - | - | - | YGFHALSVDEIKMNPQRT |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2989 | R | - | - | - | - | RILTAGSDEFHKMNPQVY |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2990 | A | - | - | - | - | SAVNQPDEGIKLRT |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2991 | L | - | - | - | - | LKMGADQREINPSTV |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2992 | S | - | - | - | - | PSDN |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2993 | G | - | - | - | - | GD |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2994 | V | - | - | - | - | VYTF |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2995 | F | - | - | - | - | FVYI |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2996 | C | - | - | - | - | C |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2997 | G | - | - | - | - | G |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2998 | V | - | - | - | - | TSRVDN |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
2999 | D | - | - | - | - | DGSNT |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
3000 | A | - | - | - | - | AVLFTY |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
3001 | M | - | - | - | - | FRIMLWV |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
3002 | N | - | - | - | - | DNEGST |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
3003 | L | - | - | - | - | LFI |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
3004 | I | - | - | - | - | IFLVM |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
3005 | A | - | - | - | - | FMAKRHYVT |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
3006 | N | - | - | - | - | NQRS |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
3007 | I | - | - | - | - | VMILF |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
3008 | F | - | - | - | - | FLVIAG |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
3009 | T | - | - | - | - | SGTLKAV |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
3010 | P | - | - | - | - | PSGTMLIV |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
3011 | L | - | - | - | - | FLI |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
3012 | V | - | - | - | - | FSVNIA |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
3013 | Q | - | - | - | - | QSTRKN |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
3014 | P | - | - | - | - | PSGNT |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
3015 | V | - | - | - | - | VIFM |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
3016 | G | - | - | - | - | SGDNPT |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
3017 | A | - | - | - | - | VAFPY |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
3018 | L | - | - | - | - | FVLTADEGIKNPQRS |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
3019 | D | - | - | - | - | ADNVQS |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
3020 | V | - | - | - | - | LIMVT |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
3021 | S | - | - | - | - | STY |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
3022 | A | - | - | - | - | GATIM |
TRANSMEM /note="Helical" REGION /note="HD2" TRANSMEM /note="Helical" REGION /note="HD2" | ||
3023 | S | - | - | - | - | SQAH |
TRANSMEM /note="Helical" REGION /note="HD2" TRANSMEM /note="Helical" REGION /note="HD2" | ||
3024 | V | - | - | - | - | ILSMV |
TRANSMEM /note="Helical" REGION /note="HD2" TRANSMEM /note="Helical" REGION /note="HD2" | ||
3025 | V | - | - | - | - | LVAI |
TRANSMEM /note="Helical" REGION /note="HD2" TRANSMEM /note="Helical" REGION /note="HD2" | ||
3026 | A | - | - | - | - | ALFTMV |
TRANSMEM /note="Helical" REGION /note="HD2" TRANSMEM /note="Helical" REGION /note="HD2" | ||
3027 | G | - | - | - | - | GNM |
TRANSMEM /note="Helical" REGION /note="HD2" TRANSMEM /note="Helical" REGION /note="HD2" | ||
3028 | G | - | - | - | - | AFCIGV |
TRANSMEM /note="Helical" REGION /note="HD2" TRANSMEM /note="Helical" REGION /note="HD2" | ||
3029 | I | - | - | - | - | ILVAGM |
TRANSMEM /note="Helical" REGION /note="HD2" TRANSMEM /note="Helical" REGION /note="HD2" | ||
3030 | I | - | - | - | - | LIVF |
TRANSMEM /note="Helical" REGION /note="HD2" TRANSMEM /note="Helical" REGION /note="HD2" | ||
3031 | A | - | - | - | - | ALCG |
TRANSMEM /note="Helical" REGION /note="HD2" TRANSMEM /note="Helical" REGION /note="HD2" | ||
3032 | I | - | - | - | - | IVAFC |
TRANSMEM /note="Helical" REGION /note="HD2" TRANSMEM /note="Helical" REGION /note="HD2" | ||
3033 | L | - | - | - | - | VFLIT |
TRANSMEM /note="Helical" REGION /note="HD2" TRANSMEM /note="Helical" REGION /note="HD2" | ||
3034 | V | - | - | - | - | VAIL |
TRANSMEM /note="Helical" REGION /note="HD2" TRANSMEM /note="Helical" REGION /note="HD2" | ||
3035 | T | - | - | - | - | VTIS |
TRANSMEM /note="Helical" REGION /note="HD2" TRANSMEM /note="Helical" REGION /note="HD2" | ||
3036 | C | - | - | - | - | LACMFI |
TRANSMEM /note="Helical" REGION /note="HD2" TRANSMEM /note="Helical" REGION /note="HD2" | ||
3037 | A | - | - | - | - | AVLISCM |
TRANSMEM /note="Helical" REGION /note="HD2" TRANSMEM /note="Helical" REGION /note="HD2" | ||
3038 | A | - | - | - | - | FCAL |
TRANSMEM /note="Helical" REGION /note="HD2" TRANSMEM /note="Helical" REGION /note="HD2" | ||
3039 | Y | - | - | - | - | YFA |
TRANSMEM /note="Helical" REGION /note="HD2" TRANSMEM /note="Helical" REGION /note="HD2" | ||
3040 | Y | - | - | - | - | YLMGA |
TRANSMEM /note="Helical" REGION /note="HD2" TRANSMEM /note="Helical" REGION /note="HD2" | ||
3041 | F | - | - | - | - | VFLI |
TRANSMEM /note="Helical" REGION /note="HD2" TRANSMEM /note="Helical" REGION /note="HD2" | ||
3042 | M | - | - | - | - | ITLMN |
TRANSMEM /note="Helical" REGION /note="HD2" TRANSMEM /note="Helical" REGION /note="HD2" | ||
3043 | K | - | - | - | - | KR |
TOPO_DOM /note="Cytoplasmic" REGION /note="HD2" TOPO_DOM /note="Cytoplasmic" REGION /note="HD2" | ||
3044 | F | - | - | - | - | FLV |
TOPO_DOM /note="Cytoplasmic" REGION /note="HD2" TOPO_DOM /note="Cytoplasmic" REGION /note="HD2" | ||
3045 | R | - | - | - | - | KRQ |
TOPO_DOM /note="Cytoplasmic" REGION /note="HD2" TOPO_DOM /note="Cytoplasmic" REGION /note="HD2" | ||
3046 | R | - | - | - | - | RGK |
TOPO_DOM /note="Cytoplasmic" REGION /note="HD2" TOPO_DOM /note="Cytoplasmic" REGION /note="HD2" | ||
3047 | V | - | - | - | - | AVMIL |
TOPO_DOM /note="Cytoplasmic" REGION /note="HD2" TOPO_DOM /note="Cytoplasmic" REGION /note="HD2" | ||
3048 | F | - | - | - | - | FL |
TOPO_DOM /note="Cytoplasmic" REGION /note="HD2" TOPO_DOM /note="Cytoplasmic" REGION /note="HD2" | ||
3049 | G | - | - | - | - | GKA |
TOPO_DOM /note="Cytoplasmic" REGION /note="HD2" TOPO_DOM /note="Cytoplasmic" REGION /note="HD2" | ||
3050 | E | - | - | - | - | DEA |
TOPO_DOM /note="Cytoplasmic" REGION /note="HD2" TOPO_DOM /note="Cytoplasmic" REGION /note="HD2" | ||
3051 | Y | - | - | - | - | YLMC |
TOPO_DOM /note="Cytoplasmic" REGION /note="HD2" TOPO_DOM /note="Cytoplasmic" REGION /note="HD2" | ||
3052 | N | - | - | - | - | TSAN |
TOPO_DOM /note="Cytoplasmic" REGION /note="HD2" TOPO_DOM /note="Cytoplasmic" REGION /note="HD2" | ||
3053 | H | - | - | - | - | SHGTFYQL |
TOPO_DOM /note="Cytoplasmic" REGION /note="HD2" TOPO_DOM /note="Cytoplasmic" REGION /note="HD2" | ||
3054 | V | - | - | - | - | VIGCLT |
TOPO_DOM /note="Cytoplasmic" REGION /note="HD2" TOPO_DOM /note="Cytoplasmic" REGION /note="HD2" | ||
3055 | V | - | - | - | - | VIAF |
TOPO_DOM /note="Cytoplasmic" REGION /note="HD2" TOPO_DOM /note="Cytoplasmic" REGION /note="HD2" | ||
3056 | A | - | - | - | - | VFATDEGIKLNPQRS |
TOPO_DOM /note="Cytoplasmic" REGION /note="HD2" TOPO_DOM /note="Cytoplasmic" REGION /note="HD2" | ||
3057 | A | - | - | - | - | IVTAMQFDEGKLNPRS |
TOPO_DOM /note="Cytoplasmic" REGION /note="HD2" TOPO_DOM /note="Cytoplasmic" REGION /note="HD2" | ||
3058 | N | - | - | - | - | NAITGLSDEFHKMPQRVY |
TOPO_DOM /note="Cytoplasmic" REGION /note="HD2" TOPO_DOM /note="Cytoplasmic" REGION /note="HD2" | ||
3059 | A | - | - | - | - | VAIMTLDEFGKNPQRSY |
TOPO_DOM /note="Cytoplasmic" REGION /note="HD2" TOPO_DOM /note="Cytoplasmic" REGION /note="HD2" | ||
3060 | L | - | - | - | - | LIACVPDEGKNQRST |
TOPO_DOM /note="Cytoplasmic" REGION /note="HD2" TOPO_DOM /note="Cytoplasmic" REGION /note="HD2" | ||
3061 | L | - | - | - | - | VALTDEGIKNPQRS |
TOPO_DOM /note="Cytoplasmic" REGION /note="HD2" TOPO_DOM /note="Cytoplasmic" REGION /note="HD2" | ||
3062 | F | - | - | - | - | WFTALDEGIKNPQRSV |
TOPO_DOM /note="Cytoplasmic" REGION /note="HD2" TOPO_DOM /note="Cytoplasmic" REGION /note="HD2" | ||
3063 | L | - | - | - | - | LVCMADEGIKNPQRST |
TOPO_DOM /note="Cytoplasmic" REGION /note="HD2" TOPO_DOM /note="Cytoplasmic" REGION /note="HD2" | ||
3064 | M | - | - | - | - | ILVMN |
TOPO_DOM /note="Cytoplasmic" REGION /note="HD2" TOPO_DOM /note="Cytoplasmic" REGION /note="HD2" | ||
3065 | S | - | - | - | - | NSVAL |
TOPO_DOM /note="Cytoplasmic" REGION /note="HD2" TOPO_DOM /note="Cytoplasmic" REGION /note="HD2" | ||
3066 | F | - | - | - | - | FVANSY |
TOPO_DOM /note="Cytoplasmic" REGION /note="HD2" TOPO_DOM /note="Cytoplasmic" REGION /note="HD2" | ||
3067 | T | - | - | - | - | LTFNIAGSM |
TOPO_DOM /note="Cytoplasmic" REGION /note="HD2" TOPO_DOM /note="Cytoplasmic" REGION /note="HD2" | ||
3068 | I | - | - | - | - | VIMCLY |
TOPO_DOM /note="Cytoplasmic" REGION /note="HD2" TOPO_DOM /note="Cytoplasmic" REGION /note="HD2" | ||
3069 | L | - | - | - | - | LISCV |
TOPO_DOM /note="Cytoplasmic" REGION /note="HD2" TOPO_DOM /note="Cytoplasmic" REGION /note="HD2" | ||
3070 | C | - | - | - | - | CFYTVL |
TOPO_DOM /note="Cytoplasmic" REGION /note="HD2" TOPO_DOM /note="Cytoplasmic" REGION /note="HD2" | ||
3071 | L | - | - | - | - | VLFT |
TOPO_DOM /note="Cytoplasmic" REGION /note="HD2" TOPO_DOM /note="Cytoplasmic" REGION /note="HD2" | ||
3072 | V | - | - | - | - | VFHAEIQTL |
TOPO_DOM /note="Cytoplasmic" REGION /note="HD2" TOPO_DOM /note="Cytoplasmic" REGION /note="HD2" | ||
3073 | P | - | - | - | - | QNPSTGAVL |
TOPO_DOM /note="Cytoplasmic" REGION /note="HD2" TOPO_DOM /note="Cytoplasmic" REGION /note="HD2" | ||
3074 | A | - | - | - | - | VYANSQPTL |
TOPO_DOM /note="Cytoplasmic" REGION /note="HD2" TOPO_DOM /note="Cytoplasmic" REGION /note="HD2" | ||
3075 | Y | - | - | - | - | YNIL |
TOPO_DOM /note="Cytoplasmic" REGION /note="HD2" TOPO_DOM /note="Cytoplasmic" REGION /note="HD2" | ||
3076 | S | - | - | - | - | SPTFG |
TOPO_DOM /note="Cytoplasmic" REGION /note="HD2" TOPO_DOM /note="Cytoplasmic" REGION /note="HD2" | ||
3077 | F | - | - | - | - | FTMVYLI |
TRANSMEM /note="Helical" REGION /note="HD2" TRANSMEM /note="Helical" REGION /note="HD2" | ||
3078 | L | - | - | - | - | LVFCA |
TRANSMEM /note="Helical" REGION /note="HD2" TRANSMEM /note="Helical" REGION /note="HD2" | ||
3079 | P | - | - | - | - | PVASMGIT |
TRANSMEM /note="Helical" REGION /note="HD2" TRANSMEM /note="Helical" REGION /note="HD2" | ||
3080 | G | - | - | - | - | CVGTISLR |
TRANSMEM /note="Helical" REGION /note="HD2" TRANSMEM /note="Helical" REGION /note="HD2" | ||
3081 | V | - | - | - | - | VIPLSFQ |
TRANSMEM /note="Helical" REGION /note="HD2" TRANSMEM /note="Helical" REGION /note="HD2" | ||
3082 | Y | - | - | - | - | YLFN |
TRANSMEM /note="Helical" REGION /note="HD2" TRANSMEM /note="Helical" REGION /note="HD2" | ||
3083 | S | - | - | - | - | ASLTMR |
TRANSMEM /note="Helical" REGION /note="HD2" TRANSMEM /note="Helical" REGION /note="HD2" | ||
3084 | V | - | - | - | - | IVCAMLY |
TRANSMEM /note="Helical" REGION /note="HD2" TRANSMEM /note="Helical" REGION /note="HD2" | ||
3085 | F | - | - | - | - | LFVIAGC |
TRANSMEM /note="Helical" REGION /note="HD2" TRANSMEM /note="Helical" REGION /note="HD2" | ||
3086 | Y | - | - | - | - | YFMWL |
TRANSMEM /note="Helical" REGION /note="HD2" TRANSMEM /note="Helical" REGION /note="HD2" | ||
3087 | L | - | - | - | - | LFCYAIDEGKNPQRSTV |
TRANSMEM /note="Helical" REGION /note="HD2" TRANSMEM /note="Helical" REGION /note="HD2" | ||
3088 | Y | - | - | - | - | YIWADEGKLNPRSTV |
TRANSMEM /note="Helical" REGION /note="HD2" TRANSMEM /note="Helical" REGION /note="HD2" | ||
3089 | L | - | - | - | - | ALTCVDEGIKNPRS |
TRANSMEM /note="Helical" REGION /note="HD2" TRANSMEM /note="Helical" REGION /note="HD2" | ||
3090 | T | - | - | - | - | TSAYDEGIKLNPRV |
TRANSMEM /note="Helical" REGION /note="HD2" TRANSMEM /note="Helical" REGION /note="HD2" | ||
3091 | F | - | - | - | - | LFYCAM |
TRANSMEM /note="Helical" REGION /note="HD2" TRANSMEM /note="Helical" REGION /note="HD2" | ||
3092 | Y | - | - | - | - | YVF |
TRANSMEM /note="Helical" REGION /note="HD2" TRANSMEM /note="Helical" REGION /note="HD2" | ||
3093 | F | - | - | - | - | FTLI |
TRANSMEM /note="Helical" REGION /note="HD2" TRANSMEM /note="Helical" REGION /note="HD2" | ||
3094 | T | - | - | - | - | TPSGI |
TRANSMEM /note="Helical" REGION /note="HD2" TRANSMEM /note="Helical" REGION /note="HD2" | ||
3095 | N | - | - | - | - | RSNKAG |
TRANSMEM /note="Helical" REGION /note="HD2" TRANSMEM /note="Helical" REGION /note="HD2" | ||
3096 | D | - | - | - | - | EDNGKTY |
TRANSMEM /note="Helical" REGION /note="HD2" TRANSMEM /note="Helical" REGION /note="HD2" | ||
3097 | V | - | - | - | - | VITLP |
TRANSMEM /note="Helical" REGION /note="HD2" TRANSMEM /note="Helical" REGION /note="HD2" | ||
3098 | S | - | - | - | - | SARV |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
3099 | F | - | - | - | - | FVYIWC |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
3100 | L | - | - | - | - | IVLMP |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
3101 | A | - | - | - | - | MWAGL |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
3102 | H | - | - | - | - | HIVL |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
3103 | L | - | - | - | - | LVCI |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
3104 | Q | - | - | - | - | QSWGDAL |
TOPO_DOM /note="Lumenal" REGION /note="HD2" TOPO_DOM /note="Lumenal" REGION /note="HD2" | ||
3105 | W | - | - | - | - | WFLY |
TRANSMEM /note="Helical" REGION /note="HD2" TRANSMEM /note="Helical" REGION /note="HD2" | ||
3106 | F | - | - | - | - | LIFVAYM |
TRANSMEM /note="Helical" REGION /note="HD2" TRANSMEM /note="Helical" REGION /note="HD2" | ||
3107 | A | - | - | - | - | IVFAL |
TRANSMEM /note="Helical" REGION /note="HD2" TRANSMEM /note="Helical" REGION /note="HD2" | ||
3108 | M | - | - | - | - | MATSL |
TRANSMEM /note="Helical" REGION /note="HD2" TRANSMEM /note="Helical" REGION /note="HD2" | ||
3109 | F | - | - | - | - | YFL |
TRANSMEM /note="Helical" REGION /note="HD2" TRANSMEM /note="Helical" REGION /note="HD2" | ||
3110 | S | - | - | - | - | GISACFLT |
TRANSMEM /note="Helical" REGION /note="HD2" TRANSMEM /note="Helical" REGION /note="HD2" | ||
3111 | P | - | - | - | - | LPANTGF |
TRANSMEM /note="Helical" REGION /note="HD2" TRANSMEM /note="Helical" REGION /note="HD2" | ||
3112 | I | - | - | - | - | ILVM |
TRANSMEM /note="Helical" REGION /note="HD2" TRANSMEM /note="Helical" REGION /note="HD2" | ||
3113 | V | - | - | - | - | VAMI |
TRANSMEM /note="Helical" REGION /note="HD2" TRANSMEM /note="Helical" REGION /note="HD2" | ||
3114 | P | - | - | - | - | P |
TRANSMEM /note="Helical" REGION /note="HD2" TRANSMEM /note="Helical" REGION /note="HD2" | ||
3115 | F | - | - | - | - | WLFTI |
TRANSMEM /note="Helical" REGION /note="HD2" TRANSMEM /note="Helical" REGION /note="HD2" | ||
3116 | W | - | - | - | - | WY |
TRANSMEM /note="Helical" REGION /note="HD2" TRANSMEM /note="Helical" REGION /note="HD2" | ||
3117 | I | - | - | - | - | VLFIM |
TRANSMEM /note="Helical" REGION /note="HD2" TRANSMEM /note="Helical" REGION /note="HD2" | ||
3118 | T | - | - | - | - | TCLAVI |
TRANSMEM /note="Helical" REGION /note="HD2" TRANSMEM /note="Helical" REGION /note="HD2" | ||
3119 | A | - | - | - | - | ACVITLFM |
TRANSMEM /note="Helical" REGION /note="HD2" TRANSMEM /note="Helical" REGION /note="HD2" | ||
3120 | I | - | - | - | - | AILCWVT |
TRANSMEM /note="Helical" REGION /note="HD2" TRANSMEM /note="Helical" REGION /note="HD2" | ||
3121 | Y | - | - | - | - | YF |
TRANSMEM /note="Helical" REGION /note="HD2" TRANSMEM /note="Helical" REGION /note="HD2" | ||
3122 | V | - | - | - | - | IVLAFST |
TRANSMEM /note="Helical" REGION /note="HD2" TRANSMEM /note="Helical" REGION /note="HD2" | ||
3123 | F | - | - | - | - | FVAGILMS |
TRANSMEM /note="Helical" REGION /note="HD2" TRANSMEM /note="Helical" REGION /note="HD2" | ||
3124 | C | - | - | - | - | VCFAGSML |
TRANSMEM /note="Helical" REGION /note="HD2" TRANSMEM /note="Helical" REGION /note="HD2" | ||
3125 | I | - | - | - | - | VIAFML |
TRANSMEM /note="Helical" REGION /note="HD2" TRANSMEM /note="Helical" REGION /note="HD2" | ||
3126 | S | - | - | - | - | LISVCF |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
3127 | L | - | - | - | - | LYSFAT |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
3128 | K | - | - | - | - | NERKMDA |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
3129 | H | - | - | - | - | HYSMLADEFGIKNPQRTV |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
3130 | C | - | - | - | - | LAFVITCDEGKNPQRSY |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
3131 | H | - | - | - | - | LPFHTYADEGIKNQRSV |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
3132 | W | - | - | - | - | WSGLADEFIKNPQRTVY |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
3133 | F | - | - | - | - | LFVC |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
3134 | F | - | - | - | - | FLYMA |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
3135 | N | - | - | - | - | SPGAKN |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
3136 | N | - | - | - | - | NLTYSADEFGIKPQRV |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
3137 | Y | - | - | - | - | YLTFKCV |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
3138 | L | - | - | - | - | LCFKSVT |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
3139 | R | - | - | - | - | KRNST |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
3140 | K | - | - | - | - | KLTR |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
3141 | R | - | - | - | - | RKNHETAGLSV |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
3142 | V | - | - | - | - | VIKLADEGNPRST |
DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" | ||
3143 | M | - | - | - | - | LGFMQRV |
DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" | ||
3144 | F | - | - | - | - | FTYVS |
DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" | ||
3145 | N | - | - | - | - | EDNGS |
DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" | ||
3146 | G | - | - | - | - | GVD |
DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" | ||
3147 | V | - | - | - | - | DVNKLRCA |
DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" | ||
3148 | T | - | - | - | - | KELTSAN |
DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" | ||
3149 | F | - | - | - | - | FDNAL |
DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" | ||
3150 | S | - | - | - | - | GSCHAL |
DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" | ||
3151 | T | - | - | - | - | TSN |
DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" | ||
3152 | F | - | - | - | - | FY |
DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" | ||
3153 | E | - | - | - | - | EQD |
DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" | ||
3154 | E | - | - | - | - | ESDLN |
DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" | ||
3155 | A | - | - | - | - | AMT |
DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" | ||
3156 | A | - | - | - | - | AS |
DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" | ||
3157 | L | - | - | - | - | LAKSM |
DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" | ||
3158 | C | - | - | - | - | GTCSNQ |
DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" | ||
3159 | T | - | - | - | - | TI |
DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" | ||
3160 | F | - | - | - | - | F |
DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" | ||
3161 | L | - | - | - | - | VML |
DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" | ||
3162 | L | - | - | - | - | IL |
DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" | ||
3163 | N | - | - | - | - | DNTR |
DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" | ||
3164 | K | - | - | - | - | KMG |
DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" | ||
3165 | E | - | - | - | - | ERDHST |
DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" | ||
3166 | M | - | - | - | - | SMETVA |
DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" | ||
3167 | Y | - | - | - | - | YF |
DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" | ||
3168 | L | - | - | - | - | ELCVAQ |
DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" | ||
3169 | K | - | - | - | - | KRAT |
DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" | ||
3170 | L | - | - | - | - | LI |
DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" | ||
3171 | R | - | - | - | - | RKTAVIL |
DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" | ||
3172 | S | - | - | - | - | NSRA |
DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" | ||
3173 | E | - | - | - | - | SENDL |
DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" | ||
3174 | T | - | - | - | - | TISVAGLDEKPFNQRYCHMW |
DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" | ||
3175 | L | - | - | - | - | LGIAESVDKNPQRTFYCHMW |
DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" | ||
3176 | L | - | - | - | - | LIVSADEGKPRTCFHMNQY |
DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" | ||
3177 | P | - | - | - | - | SPTLADEFGIKNQRVY |
DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" | ||
3178 | L | - | - | - | - | LDITSNAEGVFHKMPQRY |
DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" | ||
3179 | T | - | - | - | - | DETVA |
DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" | ||
3180 | Q | - | - | - | - | KAQR |
DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" | ||
3181 | Y | - | - | - | - | YFLI |
DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" | ||
3182 | N | - | - | - | - | NKEFRS |
DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" | ||
3183 | R | - | - | - | - | RSAQKN |
DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" | ||
3184 | Y | - | - | - | - | YF |
DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" | ||
3185 | L | - | - | - | - | LAC |
DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" | ||
3186 | A | - | - | - | - | SANG |
DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" | ||
3187 | L | - | - | - | - | LSAMT |
DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" | ||
3188 | Y | - | - | - | - | YF |
DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" | ||
3189 | N | - | - | - | - | NA |
DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" | ||
3190 | K | - | - | - | - | KR |
DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" | ||
3191 | Y | - | - | - | - | YL |
DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" | ||
3192 | K | - | - | - | - | KR |
DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" | ||
3193 | Y | - | - | - | - | Y |
DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" | ||
3194 | F | - | - | - | - | YF |
DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" | ||
3195 | S | - | - | - | - | ST |
DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" | ||
3196 | G | - | - | - | - | G |
DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" | ||
3197 | A | - | - | - | - | SAKTPN |
DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" | ||
3198 | L | - | - | - | - | MAGL |
DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" | ||
3199 | D | - | - | - | - | DSGEN |
DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" | ||
3200 | T | - | - | - | - | TE |
DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" | ||
3201 | T | - | - | - | - | ATQ |
DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" | ||
3202 | S | - | - | - | - | DAST |
DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" | ||
3203 | Y | - | - | - | - | Y |
DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" | ||
3204 | R | - | - | - | - | RL |
DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" | ||
3205 | E | - | - | - | - | EQCLM |
DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" | ||
3206 | A | - | - | - | - | A |
DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" | ||
3207 | A | - | - | - | - | CAS |
DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" | ||
3208 | C | - | - | - | - | CYRFA |
DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" | ||
3209 | C | - | - | - | - | ASC |
DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" | ||
3210 | H | - | - | - | - | HQWY |
DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" | ||
3211 | L | - | - | - | - | L |
DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" | ||
3212 | A | - | - | - | - | AGVC |
DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" | ||
3213 | K | - | - | - | - | KYM |
DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" | ||
3214 | A | - | - | - | - | A |
DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" | ||
3215 | L | - | - | - | - | LM |
DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" | ||
3216 | N | - | - | - | - | EDMNLQS |
DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" | ||
3217 | D | - | - | - | - | DTQKV |
DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" | ||
3218 | F | - | - | - | - | YF |
DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" | ||
3219 | S | - | - | - | - | SANRT |
DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" | ||
3220 | N | - | - | - | - | NEVKRS |
DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" | ||
3221 | S | - | - | - | - | SNDTG |
DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" | ||
3222 | G | - | - | - | - | GHR |
DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" | ||
3223 | A | - | - | - | - | NSVAGMT |
DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" | ||
3224 | D | - | - | - | - | DE |
DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" | ||
3225 | V | - | - | - | - | VMITKL |
DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" | ||
3226 | L | - | - | - | - | LVI |
DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" | ||
3227 | Y | - | - | - | - | YF |
DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" | ||
3228 | Q | - | - | - | - | QTS |
DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" | ||
3229 | P | - | - | - | - | P |
DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" | ||
3230 | P | - | - | - | - | P |
DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" | ||
3231 | Q | - | - | - | - | TRQN |
DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" | ||
3232 | T | - | - | - | - | VACTYI |
DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" | ||
3233 | S | - | - | - | - | S |
DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" | ||
3234 | I | - | - | - | - | VIY |
DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" | ||
3235 | T | - | - | - | - | TNGSA |
DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" | ||
3236 | S | - | - | - | - | STV |
DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" | ||
3237 | A | - | - | - | - | STAG |
DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" | ||
3238 | V | - | - | - | - | VFRAGLDEIKNPSTCHMQY |
DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" | ||
3239 | L | - | - | - | - | L |
DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" | ||
3240 | Q | - | - | - | - | Q |
SITE /note="Cleavage; by 3CL-PRO" DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" SITE /note="Cleavage; by 3CL-PRO" DISORDER predicted by DISOPRED DOMAIN /note="Nsp4C" TOPO_DOM /note="Cytoplasmic" | ||
3241 | S | e | 128.1 | 7lmh_A | hetero compound NOL ZU3 ZU5 G83 J7R homo precipitant | SA |
SITE /note="Cleavage; by 3CL-PRO" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" SITE /note="Cleavage; by 3CL-PRO" DISORDER predicted by DISOPRED DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | ||
3242 | G | e | 54.8 | 7lmh_A | homo | G |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | ||
3243 | F | b | 13.9 | 7lmh_A | homo | LFI |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | ||
3244 | R | e | 77.1 | 7lmh_A | homo precipitant | RVKT |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | ||
3245 | K | e | 40.1 | 7lmh_A | homo precipitant | KR |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | ||
3246 | M | e | 39.6 | 7lmh_A | homo precipitant | ML |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | ||
3247 | A | e | 23.2 | 7lmh_A | homo precipitant | AVS |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | ||
3248 | F | b | 10.0 | 7lmh_A | homo precipitant | QSFHAN |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | ||
3249 | P | e | 81.4 | 7lmh_A | homo | P |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | ||
3250 | S | b | 13.3 | 7lmh_A | homo | ST |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | ||
3251 | G | H | e | 54.8 | 7lmh_A | homo precipitant | GS |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | |
3252 | K | H | e | 34.4 | 7lmh_A | precipitant | KVALCDFI |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | |
3253 | V | H | b | 0.0 | 7lmh_A | VI |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | ||
3254 | E | H | e | 45.2 | 7lmh_A | homo precipitant | E |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | |
3255 | G | T | e | 21.4 | 7lmh_A | precipitant | PKGANR |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | |
3256 | C | T | b | 0.7 | 7lmh_A | precipitant | C |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | |
3257 | M | E | b | 5.8 | 7lmh_A | precipitant | IMVL |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | |
3258 | V | E | b | 1.3 | 7lmh_A | precipitant | V |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | |
3259 | Q | E | b | 16.3 | 7lmh_A | precipitant | RSQK |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | |
3260 | V | E | b | 0.0 | 7lmh_A | V |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | ||
3261 | T | E | b | 13.6 | 7lmh_A | TSCNA |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | ||
3262 | C | E | b | 4.7 | 7lmh_A | precipitant | YC |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | |
3263 | G | T | e | 81.0 | 7lmh_A | precipitant | GR |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | |
3264 | T | T | e | 96.8 | 7lmh_A | hetero compound 7YY precipitant | NSTG |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | |
3265 | T | E | e | 27.3 | 7lmh_A | hetero compound AZP 9IN ZU3 ZU5 G82 0EN D03 X77 X47 V34 Y6G Y6D Y67 7YY WYR I12 HUR precipitant | MTNL |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | |
3266 | T | E | e | 32.5 | 7lmh_A | hetero compound AZP I12 CY6 9IN ENB F3F ZU3 ZU5 G82 0EN 8O5 X77 X47 V34 OEW VR4 80I XNV 7YY WYR 3WL | TVNA |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | |
3267 | L | E | b | 3.9 | 7lmh_A | hetero compound CY6 9IN ENB D3F XP1 ZU3 ZU5 G83 V2M 4IO HUR XNV 7YY AZP 3WL precipitant | L |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | |
3268 | N | E | b | 0.0 | 7lmh_A | N |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | ||
3269 | G | E | b | 0.0 | 7lmh_A | G |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | ||
3270 | L | E | b | 0.0 | 7lmh_A | LIV |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | ||
3271 | W | E | b | 7.6 | 7lmh_A | precipitant | W |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | |
3272 | L | E | b | 0.6 | 7lmh_A | L |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | ||
3273 | D | T | e | 41.4 | 7lmh_A | DG |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | ||
3274 | D | T | e | 35.2 | 7lmh_A | DN |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | ||
3275 | T | E | b | 11.0 | 7lmh_A | precipitant | TKIEFSYV |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | |
3276 | V | E | b | 0.0 | 7lmh_A | VI |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | ||
3277 | Y | E | b | 4.8 | 7lmh_A | YIWMT |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | ||
3278 | C | E | b | 0.0 | 7lmh_A | C |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | ||
3279 | P | E | b | 0.0 | 7lmh_A | compound D3F XP1 4IO FNO | P |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | |
3280 | R | G | b | 11.5 | 7lmh_A | precipitant | R |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | |
3281 | H | G | b | 15.2 | 7lmh_A | hetero compound AZP UED I12 CY6 9IN ENB NOL D3F F3F WR1 XP1 TLD ZU3 ZU5 959 S89 G75 G82 G83 G85 0EN 23H D03 8O5 X77 X47 V2M V3D V34 OEW J7R VR4 Y6G Y6D Y6A Y67 4IO 4WI 80I HUR XNV 7YY WYR BEZ EJF EOC EOF FNO 3WL metal ZN HG precipitant | H |
ACT_SITE /note="For 3CL-PRO activity" ECO:0000269|PubMed:16306590" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" ACT_SITE /note="For 3CL-PRO activity" ECO:0000269|PubMed:16306590" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | |
3282 | V | G | b | 0.0 | 7lmh_A | precipitant | V |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | |
3283 | I | G | b | 3.5 | 7lmh_A | precipitant | IMLV |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | |
3284 | C | b | 3.3 | 7lmh_A | compound CY6 G82 G83 G85 23H D03 Y6G Y6D Y6A Y67 AZP metal HG precipitant | CADEGIKLNPQRSTV |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | ||
3285 | T | e | 41.6 | 7lmh_A | compound 23H D03 Y6G Y6D Y6A Y67 precipitant | SPTLADEGIKNQRV |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | ||
3286 | A | T | e | 69.6 | 7lmh_A | compound 23H D03 Y6G Y6D Y6A Y67 precipitant | SATDREGIKLNPQV |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | |
3287 | E | G | e | 71.4 | 7lmh_A | TDEGAS |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | ||
3288 | D | G | e | 30.2 | 7lmh_A | compound 4WI 3WL HUR UED | DSKTQNE |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | |
3289 | M | G | b | 15.9 | 7lmh_A | hetero compound AZP I12 9IN ENB NOL WR1 XP1 ZU3 ZU5 959 S89 G75 G81 G83 G85 0EN 23H D03 8O5 X77 X47 OEW J7R UED Y6G Y6D Y6A Y67 4IO XNV BEZ EOC EOF V3D VR4 HUR metal HG precipitant | MLFVRAT |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | |
3290 | L | G | e | 69.1 | 7lmh_A | hetero | SLITVAN |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | |
3291 | N | S | e | 80.0 | 7lmh_A | DNGELAFIKPQRSTVY |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | ||
3292 | P | b | 12.4 | 7lmh_A | PYID |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | |||
3293 | N | e | 54.5 | 7lmh_A | precipitant | DNQ |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | ||
3294 | Y | H | b | 2.2 | 7lmh_A | hetero compound AZP CY6 NOL G82 G83 G85 OEW I12 EJF 4WI metal HG precipitant | YWH |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | |
3295 | E | H | e | 59.8 | 7lmh_A | EDPASGNT |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | ||
3296 | D | H | e | 45.7 | 7lmh_A | precipitant | DNARHLMY |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | |
3297 | L | H | b | 14.0 | 7lmh_A | LSVEA |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | ||
3298 | L | H | b | 9.6 | 7lmh_A | LSIMVY |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | ||
3299 | I | H | e | 78.9 | 7lmh_A | ICSMNVL |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | ||
3300 | R | T | e | 68.4 | 7lmh_A | precipitant | RSLT |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | |
3301 | K | e | 31.1 | 7lmh_A | precipitant | VKALM |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | ||
3302 | S | e | 27.3 | 7lmh_A | TRSNAILDEFGKPQVY |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | |||
3303 | N | G | e | 29.7 | 7lmh_A | hetero precipitant | NLSADEFGIKPQRTVY |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | |
3304 | H | G | e | 84.8 | 7lmh_A | hetero precipitant | HSYLG |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | |
3305 | S | G | e | 28.1 | 7lmh_A | NDSE |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | ||
3306 | F | E | b | 2.4 | 7lmh_A | F |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | ||
3307 | L | E | e | 48.3 | 7lmh_A | SLECTHI |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | ||
3308 | V | E | b | 0.0 | 7lmh_A | VI |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | ||
3309 | Q | E | e | 37.8 | 7lmh_A | precipitant | SQMAITVL |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | |
3310 | A | E | b | 13.4 | 7lmh_A | precipitant | SATGKQHF |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | |
3311 | G | T | e | 78.6 | 7lmh_A | precipitant | GNQAD |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | |
3312 | N | T | e | 94.5 | 7lmh_A | NRGPHT |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | ||
3313 | V | E | e | 54.7 | 7lmh_A | precipitant | VAMHL |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | |
3314 | Q | E | e | 48.0 | 7lmh_A | precipitant | FSNQT |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | |
3315 | L | E | b | 3.9 | 7lmh_A | precipitant | LI |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | |
3316 | R | e | 58.9 | 7lmh_A | GRTN |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | |||
3317 | V | E | b | 4.7 | 7lmh_A | V |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | ||
3318 | I | E | e | 44.4 | 7lmh_A | precipitant | VIM |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | |
3319 | G | E | e | 22.6 | 7lmh_A | precipitant | SG |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | |
3320 | H | E | e | 30.4 | 7lmh_A | precipitant | HAYRV |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | |
3321 | S | E | e | 44.5 | 7lmh_A | precipitant | TSQRAK |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | |
3322 | M | E | e | 25.1 | 7lmh_A | MLY |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | ||
3323 | Q | E | e | 23.5 | 7lmh_A | QKHREV |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | ||
3324 | N | T | e | 55.8 | 7lmh_A | precipitant | GN |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | |
3325 | C | T | b | 10.7 | 7lmh_A | precipitant | CSATV |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | |
3326 | L | E | b | 0.0 | 7lmh_A | LVNQTM |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | ||
3327 | L | E | b | 0.0 | 7lmh_A | L |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | ||
3328 | R | E | e | 30.4 | 7lmh_A | precipitant | VKRIHQ |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | |
3329 | L | E | b | 0.0 | 7lmh_A | LI |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | ||
3330 | K | E | e | 40.6 | 7lmh_A | precipitant | KTQ |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | |
3331 | V | E | b | 0.7 | 7lmh_A | VT |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | ||
3332 | D | S | e | 43.2 | 7lmh_A | DNSTAE |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | ||
3333 | T | S | e | 39.0 | 7lmh_A | QVLTS |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | ||
3334 | S | e | 53.1 | 7lmh_A | ASQNVT |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | |||
3335 | N | b | 3.0 | 7lmh_A | precipitant | N |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | ||
3336 | P | T | e | 88.4 | 7lmh_A | PVAMS |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | ||
3337 | K | T | e | 66.5 | 7lmh_A | precipitant | NKHEQSRY |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | |
3338 | T | e | 20.1 | 7lmh_A | T |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | |||
3339 | P | b | 14.7 | 7lmh_A | P |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | |||
3340 | K | E | e | 74.1 | 7lmh_A | precipitant | KAENR |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | |
3341 | Y | E | e | 29.1 | 7lmh_A | precipitant | YH |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | |
3342 | K | E | e | 55.7 | 7lmh_A | KTSV |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | ||
3343 | F | E | e | 29.2 | 7lmh_A | FY |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | ||
3344 | V | e | 30.7 | 7lmh_A | KVGIRT |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | |||
3345 | R | e | 39.9 | 7lmh_A | metal CA precipitant | TVRKS |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | ||
3346 | I | b | 5.8 | 7lmh_A | precipitant | VILA |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | ||
3347 | Q | e | 57.7 | 7lmh_A | precipitant | KQNRS |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | ||
3348 | P | T | e | 41.9 | 7lmh_A | precipitant | PCTAS |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | |
3349 | G | T | b | 8.3 | 7lmh_A | homo precipitant | G |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | |
3350 | Q | e | 43.4 | 7lmh_A | homo precipitant | EDQA |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | ||
3351 | T | E | b | 3.9 | 7lmh_A | homo | STAG |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | |
3352 | F | E | b | 0.0 | 7lmh_A | FM |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | ||
3353 | S | E | b | 0.0 | 7lmh_A | NST |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | ||
3354 | V | E | b | 0.0 | 7lmh_A | IVL |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | ||
3355 | L | E | b | 2.2 | 7lmh_A | homo | LA |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | |
3356 | A | E | b | 5.4 | 7lmh_A | homo | AC |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | |
3357 | C | E | b | 0.0 | 7lmh_A | CAS |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | ||
3358 | Y | E | e | 21.3 | 7lmh_A | homo precipitant | Y |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | |
3359 | N | T | e | 59.4 | 7lmh_A | precipitant | NDEG |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | |
3360 | G | T | b | 16.7 | 7lmh_A | G |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | ||
3361 | S | E | e | 58.6 | 7lmh_A | homo | RSCTKLAI |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | |
3362 | P | E | e | 39.5 | 7lmh_A | homo | PAVS |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | |
3363 | S | E | e | 64.1 | 7lmh_A | homo precipitant | QSTAGIV |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | |
3364 | G | E | e | 36.9 | 7lmh_A | homo precipitant | GS |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | |
3365 | V | E | e | 42.0 | 7lmh_A | homo precipitant | VALT |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | |
3366 | Y | E | e | 23.5 | 7lmh_A | homo precipitant | YF |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | |
3367 | Q | E | b | 8.7 | 7lmh_A | homo precipitant | GHQPTM |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | |
3368 | C | E | b | 0.7 | 7lmh_A | homo | VC |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | |
3369 | A | E | b | 0.0 | 7lmh_A | homo | NTAV |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | |
3370 | M | b | 1.0 | 7lmh_A | ML |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | |||
3371 | R | b | 5.1 | 7lmh_A | homo precipitant | R |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | ||
3372 | P | T | b | 16.3 | 7lmh_A | homo precipitant | SPTQ |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | |
3373 | N | T | b | 10.9 | 7lmh_A | precipitant | NSQ |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | |
3374 | H | S | e | 34.0 | 7lmh_A | metal CA homo precipitant | YGHFSW |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | |
3375 | T | b | 1.3 | 7lmh_A | T |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | |||
3376 | I | B | b | 0.0 | 7lmh_A | homo | IM |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | |
3377 | K | e | 60.4 | 7lmh_A | homo precipitant | KR |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | ||
3378 | G | e | 22.6 | 7lmh_A | homo | GA |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | ||
3379 | S | e | 65.6 | 7lmh_A | homo | S |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | ||
3380 | F | b | 4.3 | 7lmh_A | hetero compound AZP UED I12 CY6 9IN ENB NOL ZU3 ZU5 S89 G75 G81 G82 G83 G85 0EN 23H D03 8O5 X77 X47 V2M V3D V34 OEW J7R VR4 Y6G Y6D Y6A Y67 4WI 80I HUR XNV 7YY WYR EJF EOC EOF homo precipitant | F |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | ||
3381 | L | e | 72.5 | 7lmh_A | hetero compound AZP UED CY6 ENB NOL F3F WR1 ZU3 ZU5 S89 G75 G81 G82 G83 G85 0EN 23H D03 8O5 X77 X47 V2M V3D V34 OEW J7R VR4 Y6G Y6D Y6A Y67 80I HUR 7YY I12 XP1 EJF EOC EOF 4WI 3WL homo precipitant | LI |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | ||
3382 | N | T | e | 98.8 | 7lmh_A | hetero compound AZP UED I12 CY6 9IN ENB NOL F3F TLD ZU3 ZU5 959 S89 G75 G81 G82 G83 G85 0EN 23H D03 8O5 X77 X47 V2M V3D V34 OEW J7R VR4 Y6G Y6D Y6A Y67 4WI 80I HUR XNV 7YY WYR WR1 XP1 EJF EOC EOF 3WL homo precipitant | CNAS |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | |
3383 | G | T | e | 26.2 | 7lmh_A | hetero compound AZP UED I12 CY6 9IN ENB NOL F3F WR1 ZU3 ZU5 959 S89 G75 G81 G82 G83 G85 0EN D03 8O5 X77 X47 V2M V3D V34 OEW VR4 4WI 80I HUR XNV 7YY WYR XP1 EJF EOC EOF 3WL precipitant | G |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | |
3384 | S | b | 2.3 | 7lmh_A | hetero compound AZP UED I12 CY6 9IN ENB NOL F3F WR1 ZU3 ZU5 959 S89 G75 G81 G82 G83 G85 0EN 23H D03 8O5 X77 X47 V2M V3D V34 OEW J7R VR4 Y6G Y6D Y6A Y67 4WI 80I HUR XNV 7YY WYR EJF EOC EOF 3WL precipitant | SAT |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | ||
3385 | C | T | b | 14.0 | 7lmh_A | hetero compound AZP UED XP1 I12 CY6 9IN ENB NOL D3F F3F WR1 TLD ZU3 ZU5 959 S89 G75 G81 G82 G83 G85 0EN 23H D03 8O5 X77 X47 V2M V3D V34 OEW J7R VR4 Y6G Y6D Y6A Y67 4IO 4WI 80I HUR XNV 7YY WYR EJF EOC EOF FNO 3WL metal ZN precipitant | C |
ACT_SITE /note="For 3CL-PRO activity" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" ACT_SITE /note="For 3CL-PRO activity" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | |
3386 | G | T | b | 0.0 | 7lmh_A | G |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | ||
3387 | S | b | 0.0 | 7lmh_A | S |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | |||
3388 | V | E | b | 0.0 | 7lmh_A | VP |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | ||
3389 | G | E | b | 0.0 | 7lmh_A | G |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | ||
3390 | F | E | b | 0.0 | 7lmh_A | YF |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | ||
3391 | N | E | e | 20.6 | 7lmh_A | NVT |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | ||
3392 | I | E | b | 13.5 | 7lmh_A | ILMKQV |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | ||
3393 | D | E | e | 50.6 | 7lmh_A | ENDTKRM |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | ||
3394 | Y | T | e | 89.1 | 7lmh_A | GNYK |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | ||
3395 | D | T | e | 69.8 | 7lmh_A | GDKNS |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | ||
3396 | C | E | b | 8.7 | 7lmh_A | VCTSEI |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | ||
3397 | V | E | b | 0.0 | 7lmh_A | VIL |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | ||
3398 | S | E | b | 14.8 | 7lmh_A | ENSYRKQ |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | ||
3399 | F | E | b | 0.0 | 7lmh_A | F |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | ||
3400 | C | E | b | 0.0 | 7lmh_A | CVF |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | ||
3401 | Y | E | b | 0.9 | 7lmh_A | Y |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | ||
3402 | M | E | b | 0.0 | 7lmh_A | ML |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | ||
3403 | H | E | b | 1.6 | 7lmh_A | hetero compound AZP UED I12 CY6 9IN ENB NOL ZU3 ZU5 S89 G75 G81 G82 G83 G85 0EN 23H D03 8O5 X77 X47 V2M V3D V34 OEW J7R VR4 Y6G Y6D Y6A Y67 4WI 80I HUR XNV 7YY WYR XP1 EJF EOC EOF metal CL precipitant | H |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | |
3404 | H | E | b | 2.6 | 7lmh_A | hetero compound AZP UED I12 CY6 9IN ENB NOL D3F WR1 XP1 ZU3 ZU5 959 S89 G75 G81 G82 G83 G85 0EN 23H D03 8O5 X77 X47 V2M V3D V34 OEW J7R VR4 Y6G Y6D Y6A Y67 4IO 4WI 80I HUR XNV 7YY WYR BEZ EJF EOC EOF FNO 3WL precipitant | QH |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | |
3405 | M | E | b | 15.5 | 7lmh_A | hetero compound AZP UED I12 CY6 9IN ENB NOL D3F F3F WR1 XP1 ZU3 ZU5 959 S89 G75 G81 G82 G83 G85 0EN 23H D03 8O5 X77 X47 V2M V3D V34 OEW J7R VR4 Y6G Y6D Y6A Y67 4IO 4WI 80I HUR XNV 7YY WYR BEZ EJF EOC EOF FNO 3WL precipitant | LMI |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | |
3406 | E | E | e | 57.8 | 7lmh_A | hetero compound AZP UED I12 CY6 9IN ENB NOL D3F F3F WR1 ZU3 ZU5 S89 G75 G81 G82 G83 G85 0EN 23H D03 8O5 X77 X47 V2M V3D V34 OEW J7R VR4 Y6G Y6D Y6A Y67 4IO 4WI 80I HUR XNV 7YY WYR XP1 EJF EOC EOF 3WL metal CL homo precipitant | E |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | |
3407 | L | b | 4.5 | 7lmh_A | hetero compound AZP CY6 NOL D3F G83 23H OEW 4IO 4WI XNV 9IN precipitant | L |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | ||
3408 | P | T | e | 86.0 | 7lmh_A | hetero compound AZP I12 CY6 9IN ENB NOL F3F ZU3 ZU5 G82 G83 G85 23H V2M V3D OEW 4WI HUR XNV WYR EJF V34 VR4 80I UED precipitant | GPSA |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | |
3409 | T | T | e | 66.9 | 7lmh_A | homo precipitant | NTS |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | |
3410 | G | S | e | 39.3 | 7lmh_A | homo | GAE |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | |
3411 | V | b | 10.0 | 7lmh_A | CTSVLA |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | |||
3412 | H | E | b | 1.6 | 7lmh_A | hetero compound AZP UED I12 CY6 9IN ENB NOL ZU3 ZU5 G75 G81 G82 G83 G85 D03 8O5 V2M V3D V34 OEW VR4 4WI 80I HUR XNV WYR EJF EOC EOF 7YY homo precipitant | H |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | |
3413 | A | E | b | 0.9 | 7lmh_A | TVA |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | ||
3414 | G | E | b | 0.0 | 7lmh_A | G |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | ||
3415 | T | E | b | 0.0 | 7lmh_A | TSC |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | ||
3416 | D | b | 4.9 | 7lmh_A | DANS |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | |||
3417 | L | T | b | 0.6 | 7lmh_A | FLM |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | ||
3418 | E | T | e | 52.8 | 7lmh_A | DESMTN |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | ||
3419 | G | S | b | 0.0 | 7lmh_A | G |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | ||
3420 | K | e | 47.2 | 7lmh_A | precipitant | VENKTSD |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | ||
3421 | F | B | b | 2.9 | 7lmh_A | precipitant | FMV |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | |
3422 | Y | S | b | 2.2 | 7lmh_A | precipitant | Y |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | |
3423 | G | S | b | 19.0 | 7lmh_A | metal CA precipitant | G |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | |
3424 | P | S | e | 82.2 | 7lmh_A | homo precipitant | PGAKN |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | |
3425 | F | b | 5.3 | 7lmh_A | compound AZP precipitant | YF |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | ||
3426 | V | e | 25.3 | 7lmh_A | compound G75 D03 J7R Y6D WR1 BEZ | EVRDMK |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | ||
3427 | D | S | b | 3.7 | 7lmh_A | hetero compound AZP UED I12 CY6 9IN NOL D3F WR1 XP1 ZU3 ZU5 S89 G75 G81 G82 G83 G85 0EN D03 8O5 X77 X47 V2M V34 OEW J7R VR4 Y6D Y67 4IO 4WI XNV 7YY WYR ENB BEZ EJF EOC EOF V3D FNO HUR precipitant | D |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | |
3428 | R | S | e | 42.3 | 7lmh_A | hetero compound AZP UED I12 CY6 9IN NOL D3F F3F WR1 XP1 959 S89 G75 G81 G82 G83 G85 23H D03 X77 X47 OEW J7R Y6G Y6D Y6A Y67 4IO 4WI HUR 7YY BEZ EJF EOC EOF V3D FNO 80I 3WL precipitant | QRAEK |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | |
3429 | Q | e | 54.6 | 7lmh_A | hetero compound AZP UED I12 CY6 9IN ENB NOL D3F F3F WR1 XP1 ZU3 ZU5 959 S89 G75 G81 G82 G83 G85 23H D03 8O5 X77 X47 V2M V3D V34 OEW J7R VR4 Y6G Y6D Y6A Y67 4IO 4WI 80I HUR XNV 7YY WYR BEZ EOC EOF FNO 3WL precipitant | QPE |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | ||
3430 | T | S | e | 46.1 | 7lmh_A | hetero compound AZP I12 CY6 9IN ENB NOL D3F F3F ZU3 ZU5 G82 G83 G85 8O5 V2M V3D V34 J7R 4IO 4WI HUR XNV WYR EJF EOF VR4 UED metal CL precipitant | VTSN |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | |
3431 | A | S | e | 93.8 | 7lmh_A | hetero compound AZP I12 CY6 9IN ENB NOL ZU3 ZU5 G82 G83 G85 V2M V3D V34 HUR WYR EJF EOF VR4 4WI UED | ALVHMP |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | |
3432 | Q | b | 17.3 | 7lmh_A | hetero compound AZP I12 CY6 9IN ENB NOL D3F F3F ZU3 ZU5 G82 G83 G85 J7R 4IO 4WI WYR EJF UED precipitant | Q |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | ||
3433 | A | e | 56.2 | 7lmh_A | compound AZP | LVARI |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | ||
3434 | A | e | 24.1 | 7lmh_A | precipitant | EAPVQ |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | ||
3435 | G | e | 52.4 | 7lmh_A | precipitant | GVPSLA |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | ||
3436 | T | e | 87.0 | 7lmh_A | TAPQSK |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | |||
3437 | D | e | 22.8 | 7lmh_A | homo | DNS |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | ||
3438 | T | e | 21.4 | 7lmh_A | homo | NYTKVCLQS |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | ||
3439 | T | B | e | 22.7 | 7lmh_A | homo | TLMYIV |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | |
3440 | I | b | 2.3 | 7lmh_A | homo precipitant | IQVLCSF |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | ||
3441 | T | H | b | 0.0 | 7lmh_A | homo | TS |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | |
3442 | L | H | b | 11.2 | 7lmh_A | homo precipitant | VDNELI |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | |
3443 | N | H | b | 1.2 | 7lmh_A | homo precipitant | N |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | |
3444 | V | H | b | 0.0 | 7lmh_A | homo | VIF |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | |
3445 | L | H | b | 0.0 | 7lmh_A | homo | VLCI |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | |
3446 | A | H | b | 0.0 | 7lmh_A | homo | AS |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | |
3447 | W | H | b | 1.6 | 7lmh_A | homo | WF |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | |
3448 | L | H | b | 0.0 | 7lmh_A | homo | L |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | |
3449 | Y | H | b | 0.0 | 7lmh_A | homo | Y |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | |
3450 | A | H | b | 0.0 | 7lmh_A | homo | AG |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | |
3451 | A | H | b | 0.0 | 7lmh_A | homo | A |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | |
3452 | V | H | b | 2.0 | 7lmh_A | homo | ILV |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | |
3453 | I | H | b | 1.8 | 7lmh_A | homo | ILF |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | |
3454 | N | T | b | 15.8 | 7lmh_A | homo precipitant | NS |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | |
3455 | G | T | e | 42.9 | 7lmh_A | GRNQV |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | ||
3456 | D | e | 34.6 | 7lmh_A | homo precipitant | CDEKPS |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | ||
3457 | R | e | 54.9 | 7lmh_A | RNKTA |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | |||
3458 | W | T | e | 26.3 | 7lmh_A | homo precipitant | W |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | |
3459 | F | T | b | 1.9 | 7lmh_A | homo precipitant | FWADEGIKLNPQRSTV |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | |
3460 | L | b | 18.0 | 7lmh_A | homo precipitant | LV |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | ||
3461 | N | e | 24.8 | 7lmh_A | homo | QTKNESC |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | ||
3462 | R | S | e | 82.6 | 7lmh_A | homo | SNRPKG |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | |
3463 | F | e | 44.5 | 7lmh_A | homo | TDFSNEV |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | ||
3464 | T | e | 56.5 | 7lmh_A | homo | STRKV |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | ||
3465 | T | b | 6.5 | 7lmh_A | TVCIML |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | |||
3466 | T | e | 47.4 | 7lmh_A | metal CA | STGAFN |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | ||
3467 | L | H | e | 20.8 | 7lmh_A | metal CA | VLIP |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | |
3468 | N | H | e | 75.2 | 7lmh_A | metal CA homo | EDNAV |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | |
3469 | D | H | e | 51.2 | 7lmh_A | homo | DESTGHR |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | |
3470 | F | H | b | 0.0 | 7lmh_A | homo | FY |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | |
3471 | N | H | b | 11.5 | 7lmh_A | homo | N |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | |
3472 | L | H | e | 62.4 | 7lmh_A | homo | EVLNAKRT |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | |
3473 | V | H | b | 6.7 | 7lmh_A | WVC |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | ||
3474 | A | H | b | 0.0 | 7lmh_A | A |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | ||
3475 | M | H | e | 51.2 | 7lmh_A | homo | MLVKGQS |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | |
3476 | K | H | e | 74.5 | 7lmh_A | metal CL homo | TKADSHR |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | |
3477 | Y | T | e | 43.9 | 7lmh_A | metal CL | NY |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | |
3478 | N | T | e | 53.9 | 7lmh_A | homo | GNQSM |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | |
3479 | Y | B | b | 8.3 | 7lmh_A | homo | FYMC |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | |
3480 | E | e | 24.1 | 7lmh_A | homo precipitant | TESQ |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | ||
3481 | P | e | 49.6 | 7lmh_A | PSAEFQL |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | |||
3482 | L | b | 1.7 | 7lmh_A | homo | VLIFM |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | ||
3483 | T | e | 36.4 | 7lmh_A | precipitant | TKSGNV |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | ||
3484 | Q | H | e | 52.6 | 7lmh_A | precipitant | STAQGVL |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | |
3485 | D | H | e | 70.4 | 7lmh_A | homo precipitant | DESQGALFHIKMNPRTVY |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | |
3486 | H | H | e | 23.0 | 7lmh_A | homo precipitant | LSHTNAGVDEFIKMPQRY |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | |
3487 | V | H | b | 12.0 | 7lmh_A | precipitant | VTAL |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | |
3488 | D | H | e | 60.5 | 7lmh_A | homo precipitant | DEQLAGIKPRSTVCFHMNY |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | |
3489 | I | H | e | 49.7 | 7lmh_A | homo | ACIMVLDEGKPRSTFHNQY |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | |
3490 | L | T | b | 0.0 | 7lmh_A | homo | LFIY |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | |
3491 | G | H | e | 36.9 | 7lmh_A | SDGTQNAEIKLPRV |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | ||
3492 | P | H | e | 69.8 | 7lmh_A | precipitant | PAIKMLDEGNRSTV |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | |
3493 | L | H | b | 1.7 | 7lmh_A | homo | LADEGIKNPRSTV |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | |
3494 | S | H | b | 18.0 | 7lmh_A | homo precipitant | ASV |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | |
3495 | A | H | e | 73.2 | 7lmh_A | ASHV |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | ||
3496 | Q | H | e | 29.6 | 7lmh_A | homo precipitant | KMQI |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | |
3497 | T | H | b | 11.0 | 7lmh_A | homo | T |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | |
3498 | G | T | e | 83.3 | 7lmh_A | G |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | ||
3499 | I | b | 7.6 | 7lmh_A | homo | VIQY |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | ||
3500 | A | e | 38.4 | 7lmh_A | homo precipitant | SADTCEGIKLNPQRV |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | ||
3501 | V | H | b | 9.3 | 7lmh_A | homo precipitant | VILADEGKNPQRST |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | |
3502 | L | H | e | 32.0 | 7lmh_A | precipitant | ELGQADIKNPRSTV |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | |
3503 | D | H | e | 40.1 | 7lmh_A | homo | DQRKT |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | |
3504 | M | H | b | 0.0 | 7lmh_A | homo | LMVI |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | |
3505 | C | H | b | 0.0 | 7lmh_A | homo | LC |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | |
3506 | A | H | b | 4.5 | 7lmh_A | homo | AKYSDEH |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | |
3507 | A | H | b | 0.0 | 7lmh_A | homo | ASLC |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | |
3508 | L | H | b | 0.0 | 7lmh_A | homo | IL |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | |
3509 | K | H | b | 18.9 | 7lmh_A | KQRVADEGILNPST |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | ||
3510 | E | H | e | 33.2 | 7lmh_A | homo precipitant | RQETVHKS |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | |
3511 | L | H | b | 5.6 | 7lmh_A | homo precipitant | LIVTADEGKPRS |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | |
3512 | L | H | b | 11.8 | 7lmh_A | LYMHADEFGIKNPQRSTV |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | ||
3513 | Q | H | e | 50.5 | 7lmh_A | metal CL homo | NHQKSGVMAELT |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | |
3514 | N | H | e | 62.4 | 7lmh_A | homo | NKSAET |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | |
3515 | G | e | 41.7 | 7lmh_A | GQSADEIKLNPRTV |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | |||
3516 | M | b | 10.1 | 7lmh_A | homo | FMAW |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | ||
3517 | N | T | e | 87.9 | 7lmh_A | homo | GQNC |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | |
3518 | G | T | e | 103.6 | 7lmh_A | GW |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | ||
3519 | R | e | 54.2 | 7lmh_A | homo precipitant | KRDG |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | ||
3520 | T | e | 42.2 | 7lmh_A | homo precipitant | TQSNP |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | ||
3521 | I | B | b | 0.0 | 7lmh_A | homo | I |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | |
3522 | L | T | e | 28.1 | 7lmh_A | homo | LM |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | |
3523 | G | T | e | 79.8 | 7lmh_A | homo | GS |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | |
3524 | S | B | b | 18.0 | 7lmh_A | homo | SYQCHN |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | |
3525 | T | S | e | 65.6 | 7lmh_A | homo | TCSYGA |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | |
3526 | I | S | e | 59.6 | 7lmh_A | homo precipitant | SNIMVTL |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | |
3527 | L | b | 18.5 | 7lmh_A | homo precipitant | LF |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | ||
3528 | E | e | 22.6 | 7lmh_A | homo precipitant | ECNT |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | ||
3529 | D | b | 10.5 | 7lmh_A | homo precipitant | D |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | ||
3530 | E | S | b | 9.5 | 7lmh_A | homo precipitant | E |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | |
3531 | F | b | 6.7 | 7lmh_A | homo | FLH |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | ||
3532 | T | b | 9.7 | 7lmh_A | homo | TSA |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | ||
3533 | P | H | b | 12.4 | 7lmh_A | homo precipitant | PLIT |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | |
3534 | F | H | e | 57.9 | 7lmh_A | precipitant | SEFTYADGN |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | |
3535 | D | H | b | 3.7 | 7lmh_A | homo precipitant | DES |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | |
3536 | V | H | b | 0.0 | 7lmh_A | homo | VI |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | |
3537 | V | H | e | 54.7 | 7lmh_A | precipitant | VYFING |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | |
3538 | R | H | e | 31.2 | 7lmh_A | homo precipitant | RQKNM |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | |
3539 | Q | H | e | 21.9 | 7lmh_A | homo precipitant | Q |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | |
3540 | C | S | b | 10.7 | 7lmh_A | homo | MLCIV |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | |
3541 | S | e | 53.1 | 7lmh_A | homo precipitant | YASGMLF |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | ||
3542 | G | S | e | 76.2 | 7lmh_A | homo | G |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | |
3543 | V | S | e | 75.3 | 7lmh_A | homo | VI |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | |
3544 | T | b | 13.0 | 7lmh_A | homo | NKTRV |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | ||
3545 | F | e | 73.7 | 7lmh_A | homo precipitant | LFM |
DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | ||
3546 | Q | e | 114.3 | 7lmh_A | Q |
SITE /note="Cleavage; by 3CL-PRO" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED SITE /note="Cleavage; by 3CL-PRO" DOMAIN /note="Peptidase C30" TOPO_DOM /note="Cytoplasmic" | |||
3547 | G | - | - | - | - | SG |
SITE /note="Cleavage; by 3CL-PRO" TOPO_DOM /note="Cytoplasmic" SITE /note="Cleavage; by 3CL-PRO" TOPO_DOM /note="Cytoplasmic" | ||
3548 | K | - | - | - | - | KGSA |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
3549 | F | - | - | - | - | FVRTYL |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
3550 | K | - | - | - | - | KTQSRAEGLVDFHIMNPY |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
3551 | K | - | - | - | - | RKSAEGLVDFHIMNPQTY |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
3552 | I | - | - | - | - | VIMALFTDEGKNPQRSY |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
3553 | V | - | - | - | - | VIFSTADEGKLNPR |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
3554 | K | - | - | - | - | KRYFADEGILNPSTV |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
3555 | G | - | - | - | - | GKASWNEDILPRTV |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
3556 | T | - | - | - | - | TALICS |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
3557 | H | - | - | - | - | HTSCVLAFKRI |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
3558 | H | - | - | - | - | HCSLQFINTY |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
3559 | W | - | - | - | - | WVFMYL |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
3560 | M | - | - | - | - | LIFVMACP |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
3561 | L | - | - | - | - | LFACIM |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
3562 | L | - | - | - | - | ALFIMTY |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
3563 | T | - | - | - | - | TSCILPV |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
3564 | F | - | - | - | - | FMLTAVI |
TRANSMEM /note="Helical" REGION /note="HD3" TRANSMEM /note="Helical" REGION /note="HD3" | ||
3565 | L | - | - | - | - | LFVM |
TRANSMEM /note="Helical" REGION /note="HD3" TRANSMEM /note="Helical" REGION /note="HD3" | ||
3566 | T | - | - | - | - | FTLWS |
TRANSMEM /note="Helical" REGION /note="HD3" TRANSMEM /note="Helical" REGION /note="HD3" | ||
3567 | S | - | - | - | - | STAVFIL |
TRANSMEM /note="Helical" REGION /note="HD3" TRANSMEM /note="Helical" REGION /note="HD3" | ||
3568 | L | - | - | - | - | LEIYCMADFGKNPQRSTV |
TRANSMEM /note="Helical" REGION /note="HD3" TRANSMEM /note="Helical" REGION /note="HD3" | ||
3569 | L | - | - | - | - | LCFVSA |
TRANSMEM /note="Helical" REGION /note="HD3" TRANSMEM /note="Helical" REGION /note="HD3" | ||
3570 | I | - | - | - | - | IAFVL |
TRANSMEM /note="Helical" REGION /note="HD3" TRANSMEM /note="Helical" REGION /note="HD3" | ||
3571 | L | - | - | - | - | ILVFTADEGKNPRS |
TRANSMEM /note="Helical" REGION /note="HD3" TRANSMEM /note="Helical" REGION /note="HD3" | ||
3572 | V | - | - | - | - | VSLYFTADEGIKNPQR |
TRANSMEM /note="Helical" REGION /note="HD3" TRANSMEM /note="Helical" REGION /note="HD3" | ||
3573 | Q | - | - | - | - | QALETDFGIKNPRSVY |
TRANSMEM /note="Helical" REGION /note="HD3" TRANSMEM /note="Helical" REGION /note="HD3" | ||
3574 | S | - | - | - | - | FSLATMDEGIKNPQRVY |
TRANSMEM /note="Helical" REGION /note="HD3" TRANSMEM /note="Helical" REGION /note="HD3" | ||
3575 | T | - | - | - | - | TVALGSDEFHIKMNPQRY |
TRANSMEM /note="Helical" REGION /note="HD3" TRANSMEM /note="Helical" REGION /note="HD3" | ||
3576 | Q | - | - | - | - | KQAINSLDEFGPRTVY |
TRANSMEM /note="Helical" REGION /note="HD3" TRANSMEM /note="Helical" REGION /note="HD3" | ||
3577 | W | - | - | - | - | WVFHY |
TRANSMEM /note="Helical" REGION /note="HD3" TRANSMEM /note="Helical" REGION /note="HD3" | ||
3578 | S | - | - | - | - | TSPLA |
TRANSMEM /note="Helical" REGION /note="HD3" TRANSMEM /note="Helical" REGION /note="HD3" | ||
3579 | L | - | - | - | - | LEMKIF |
TRANSMEM /note="Helical" REGION /note="HD3" TRANSMEM /note="Helical" REGION /note="HD3" | ||
3580 | F | - | - | - | - | FKLWV |
TRANSMEM /note="Helical" REGION /note="HD3" TRANSMEM /note="Helical" REGION /note="HD3" | ||
3581 | F | - | - | - | - | FMNADEGIKLPQRSTV |
TRANSMEM /note="Helical" REGION /note="HD3" TRANSMEM /note="Helical" REGION /note="HD3" | ||
3582 | F | - | - | - | - | YFWLADEGIKNPQRSTV |
TRANSMEM /note="Helical" REGION /note="HD3" TRANSMEM /note="Helical" REGION /note="HD3" | ||
3583 | V | - | - | - | - | VILTAG |
TRANSMEM /note="Helical" REGION /note="HD3" TRANSMEM /note="Helical" REGION /note="HD3" | ||
3584 | Y | - | - | - | - | YNTFWHADEGIKLPRSV |
TRANSMEM /note="Helical" REGION /note="HD3" TRANSMEM /note="Helical" REGION /note="HD3" | ||
3585 | E | - | - | - | - | ETPAINGL |
TOPO_DOM /note="Lumenal" REGION /note="HD3" TOPO_DOM /note="Lumenal" REGION /note="HD3" | ||
3586 | N | - | - | - | - | NGAHTVL |
TRANSMEM /note="Helical" REGION /note="HD3" TRANSMEM /note="Helical" REGION /note="HD3" | ||
3587 | A | - | - | - | - | TAVYGFIQHDEKLNPRS |
TRANSMEM /note="Helical" REGION /note="HD3" TRANSMEM /note="Helical" REGION /note="HD3" | ||
3588 | F | - | - | - | - | FIMLAPV |
TRANSMEM /note="Helical" REGION /note="HD3" TRANSMEM /note="Helical" REGION /note="HD3" | ||
3589 | L | - | - | - | - | LTVFI |
TRANSMEM /note="Helical" REGION /note="HD3" TRANSMEM /note="Helical" REGION /note="HD3" | ||
3590 | P | - | - | - | - | PGSQADEIKLNRTV |
TRANSMEM /note="Helical" REGION /note="HD3" TRANSMEM /note="Helical" REGION /note="HD3" | ||
3591 | F | - | - | - | - | FVILMADEGKNPQRST |
TRANSMEM /note="Helical" REGION /note="HD3" TRANSMEM /note="Helical" REGION /note="HD3" | ||
3592 | T | - | - | - | - | TFVALMDEGIKNPQRS |
TRANSMEM /note="Helical" REGION /note="HD3" TRANSMEM /note="Helical" REGION /note="HD3" | ||
3593 | L | - | - | - | - | LFAICPMDEGKNQRSTV |
TRANSMEM /note="Helical" REGION /note="HD3" TRANSMEM /note="Helical" REGION /note="HD3" | ||
3594 | G | - | - | - | - | LCAGVDEIKNPQRST |
TRANSMEM /note="Helical" REGION /note="HD3" TRANSMEM /note="Helical" REGION /note="HD3" | ||
3595 | I | - | - | - | - | LIVAT |
TRANSMEM /note="Helical" REGION /note="HD3" TRANSMEM /note="Helical" REGION /note="HD3" | ||
3596 | M | - | - | - | - | LMTIPSV |
TRANSMEM /note="Helical" REGION /note="HD3" TRANSMEM /note="Helical" REGION /note="HD3" | ||
3597 | A | - | - | - | - | ACLTFV |
TRANSMEM /note="Helical" REGION /note="HD3" TRANSMEM /note="Helical" REGION /note="HD3" | ||
3598 | I | - | - | - | - | LVFIAM |
TRANSMEM /note="Helical" REGION /note="HD3" TRANSMEM /note="Helical" REGION /note="HD3" | ||
3599 | A | - | - | - | - | SVLAIGM |
TRANSMEM /note="Helical" REGION /note="HD3" TRANSMEM /note="Helical" REGION /note="HD3" | ||
3600 | A | - | - | - | - | SAFLI |
TRANSMEM /note="Helical" REGION /note="HD3" TRANSMEM /note="Helical" REGION /note="HD3" | ||
3601 | C | - | - | - | - | CVFILAT |
TRANSMEM /note="Helical" REGION /note="HD3" TRANSMEM /note="Helical" REGION /note="HD3" | ||
3602 | A | - | - | - | - | ALSVM |
TRANSMEM /note="Helical" REGION /note="HD3" TRANSMEM /note="Helical" REGION /note="HD3" | ||
3603 | M | - | - | - | - | MTVLFADEGIKNPQRS |
TRANSMEM /note="Helical" REGION /note="HD3" TRANSMEM /note="Helical" REGION /note="HD3" | ||
3604 | L | - | - | - | - | LFVM |
TRANSMEM /note="Helical" REGION /note="HD3" TRANSMEM /note="Helical" REGION /note="HD3" | ||
3605 | L | - | - | - | - | LTFASV |
TRANSMEM /note="Helical" REGION /note="HD3" TRANSMEM /note="Helical" REGION /note="HD3" | ||
3606 | V | - | - | - | - | VIL |
TRANSMEM /note="Helical" REGION /note="HD3" TRANSMEM /note="Helical" REGION /note="HD3" | ||
3607 | K | - | - | - | - | K |
TOPO_DOM /note="Cytoplasmic" REGION /note="HD3" TOPO_DOM /note="Cytoplasmic" REGION /note="HD3" | ||
3608 | H | - | - | - | - | H |
TOPO_DOM /note="Cytoplasmic" REGION /note="HD3" TOPO_DOM /note="Cytoplasmic" REGION /note="HD3" | ||
3609 | K | - | - | - | - | KV |
TOPO_DOM /note="Cytoplasmic" REGION /note="HD3" TOPO_DOM /note="Cytoplasmic" REGION /note="HD3" | ||
3610 | H | - | - | - | - | HMFLTV |
TOPO_DOM /note="Cytoplasmic" REGION /note="HD3" TOPO_DOM /note="Cytoplasmic" REGION /note="HD3" | ||
3611 | A | - | - | - | - | LATF |
TOPO_DOM /note="Cytoplasmic" REGION /note="HD3" TOPO_DOM /note="Cytoplasmic" REGION /note="HD3" | ||
3612 | F | - | - | - | - | FY |
TRANSMEM /note="Helical" REGION /note="HD3" TRANSMEM /note="Helical" REGION /note="HD3" | ||
3613 | L | - | - | - | - | LFM |
TRANSMEM /note="Helical" REGION /note="HD3" TRANSMEM /note="Helical" REGION /note="HD3" | ||
3614 | C | - | - | - | - | TQCDM |
TRANSMEM /note="Helical" REGION /note="HD3" TRANSMEM /note="Helical" REGION /note="HD3" | ||
3615 | L | - | - | - | - | LVMTS |
TRANSMEM /note="Helical" REGION /note="HD3" TRANSMEM /note="Helical" REGION /note="HD3" | ||
3616 | F | - | - | - | - | FY |
TRANSMEM /note="Helical" REGION /note="HD3" TRANSMEM /note="Helical" REGION /note="HD3" | ||
3617 | L | - | - | - | - | LIV |
TRANSMEM /note="Helical" REGION /note="HD3" TRANSMEM /note="Helical" REGION /note="HD3" | ||
3618 | L | - | - | - | - | LMI |
TRANSMEM /note="Helical" REGION /note="HD3" TRANSMEM /note="Helical" REGION /note="HD3" | ||
3619 | P | - | - | - | - | P |
TRANSMEM /note="Helical" REGION /note="HD3" TRANSMEM /note="Helical" REGION /note="HD3" | ||
3620 | S | - | - | - | - | SVTA |
TRANSMEM /note="Helical" REGION /note="HD3" TRANSMEM /note="Helical" REGION /note="HD3" | ||
3621 | L | - | - | - | - | LAVI |
TRANSMEM /note="Helical" REGION /note="HD3" TRANSMEM /note="Helical" REGION /note="HD3" | ||
3622 | A | - | - | - | - | ICAMF |
TRANSMEM /note="Helical" REGION /note="HD3" TRANSMEM /note="Helical" REGION /note="HD3" | ||
3623 | T | - | - | - | - | TVCLAI |
TRANSMEM /note="Helical" REGION /note="HD3" TRANSMEM /note="Helical" REGION /note="HD3" | ||
3624 | V | - | - | - | - | VLTAF |
TRANSMEM /note="Helical" REGION /note="HD3" TRANSMEM /note="Helical" REGION /note="HD3" | ||
3625 | A | - | - | - | - | ATISFLY |
TRANSMEM /note="Helical" REGION /note="HD3" TRANSMEM /note="Helical" REGION /note="HD3" | ||
3626 | Y | - | - | - | - | YFACGILT |
TRANSMEM /note="Helical" REGION /note="HD3" TRANSMEM /note="Helical" REGION /note="HD3" | ||
3627 | F | - | - | - | - | YFLAHNTIQV |
TRANSMEM /note="Helical" REGION /note="HD3" TRANSMEM /note="Helical" REGION /note="HD3" | ||
3628 | N | - | - | - | - | NSY |
TRANSMEM /note="Helical" REGION /note="HD3" TRANSMEM /note="Helical" REGION /note="HD3" | ||
3629 | M | - | - | - | - | LIMQFCVY |
TRANSMEM /note="Helical" REGION /note="HD3" TRANSMEM /note="Helical" REGION /note="HD3" | ||
3630 | V | - | - | - | - | VWAQFLDEGIKNPRST |
TRANSMEM /note="Helical" REGION /note="HD3" TRANSMEM /note="Helical" REGION /note="HD3" | ||
3631 | Y | - | - | - | - | YVFLW |
TRANSMEM /note="Helical" REGION /note="HD3" TRANSMEM /note="Helical" REGION /note="HD3" | ||
3632 | M | - | - | - | - | MYDETHWVAGLSFIKNPQR |
TRANSMEM /note="Helical" REGION /note="HD3" TRANSMEM /note="Helical" REGION /note="HD3" | ||
3633 | P | - | - | - | - | PKDFGLAEINQRSTVY |
TOPO_DOM /note="Lumenal" REGION /note="HD3" TOPO_DOM /note="Lumenal" REGION /note="HD3" | ||
3634 | A | - | - | - | - | QAVSYCDFMEL |
TOPO_DOM /note="Lumenal" REGION /note="HD3" TOPO_DOM /note="Lumenal" REGION /note="HD3" | ||
3635 | S | - | - | - | - | STVGAYKL |
TOPO_DOM /note="Lumenal" REGION /note="HD3" TOPO_DOM /note="Lumenal" REGION /note="HD3" | ||
3636 | W | - | - | - | - | YFWAQL |
TOPO_DOM /note="Lumenal" REGION /note="HD3" TOPO_DOM /note="Lumenal" REGION /note="HD3" | ||
3637 | V | - | - | - | - | VLRYIMSADEFGKNPQT |
TOPO_DOM /note="Lumenal" REGION /note="HD3" TOPO_DOM /note="Lumenal" REGION /note="HD3" | ||
3638 | M | - | - | - | - | GMDLEITVF |
TOPO_DOM /note="Lumenal" REGION /note="HD3" TOPO_DOM /note="Lumenal" REGION /note="HD3" | ||
3639 | R | - | - | - | - | RSTKALDEY |
TOPO_DOM /note="Lumenal" REGION /note="HD3" TOPO_DOM /note="Lumenal" REGION /note="HD3" | ||
3640 | I | - | - | - | - | VLIMAEFTG |
TOPO_DOM /note="Lumenal" REGION /note="HD3" TOPO_DOM /note="Lumenal" REGION /note="HD3" | ||
3641 | M | - | - | - | - | YLMVAQEF |
TOPO_DOM /note="Lumenal" REGION /note="HD3" TOPO_DOM /note="Lumenal" REGION /note="HD3" | ||
3642 | T | - | - | - | - | ANVTPDS |
TOPO_DOM /note="Lumenal" REGION /note="HD3" TOPO_DOM /note="Lumenal" REGION /note="HD3" | ||
3643 | W | - | - | - | - | WYDEIL |
TOPO_DOM /note="Lumenal" REGION /note="HD3" TOPO_DOM /note="Lumenal" REGION /note="HD3" | ||
3644 | L | - | - | - | - | LVMKHN |
TOPO_DOM /note="Lumenal" REGION /note="HD3" TOPO_DOM /note="Lumenal" REGION /note="HD3" | ||
3645 | E | - | - | - | - | EFSNLAYD |
TOPO_DOM /note="Lumenal" REGION /note="HD3" TOPO_DOM /note="Lumenal" REGION /note="HD3" | ||
3646 | L | - | - | - | - | LPNYHDM |
TOPO_DOM /note="Lumenal" REGION /note="HD3" TOPO_DOM /note="Lumenal" REGION /note="HD3" | ||
3647 | A | - | - | - | - | AYFPTVGL |
TOPO_DOM /note="Lumenal" REGION /note="HD3" TOPO_DOM /note="Lumenal" REGION /note="HD3" | ||
3648 | D | - | - | - | - | NVDLREKS |
TOPO_DOM /note="Lumenal" REGION /note="HD3" TOPO_DOM /note="Lumenal" REGION /note="HD3" | ||
3649 | T | - | - | - | - | VTPIA |
TOPO_DOM /note="Lumenal" REGION /note="HD3" TOPO_DOM /note="Lumenal" REGION /note="HD3" | ||
3650 | S | - | - | - | - | SALYDMPT |
TOPO_DOM /note="Lumenal" REGION /note="HD3" TOPO_DOM /note="Lumenal" REGION /note="HD3" | ||
3651 | L | - | - | - | - | VLFYM |
TOPO_DOM /note="Lumenal" REGION /note="HD3" TOPO_DOM /note="Lumenal" REGION /note="HD3" | ||
3652 | S | - | - | - | - | LSTMRDIGEN |
TOPO_DOM /note="Lumenal" REGION /note="HD3" TOPO_DOM /note="Lumenal" REGION /note="HD3" | ||
3653 | G | - | - | - | - | GAQPTFDEIKLNRSV |
TOPO_DOM /note="Lumenal" REGION /note="HD3" TOPO_DOM /note="Lumenal" REGION /note="HD3" | ||
3654 | Y | - | - | - | - | FYTMV |
TOPO_DOM /note="Lumenal" REGION /note="HD3" TOPO_DOM /note="Lumenal" REGION /note="HD3" | ||
3655 | R | - | - | - | - | DKTNRHY |
TOPO_DOM /note="Lumenal" REGION /note="HD3" TOPO_DOM /note="Lumenal" REGION /note="HD3" | ||
3656 | L | - | - | - | - | VLYMAIDEGKNPRST |
TOPO_DOM /note="Lumenal" REGION /note="HD3" TOPO_DOM /note="Lumenal" REGION /note="HD3" | ||
3657 | K | - | - | - | - | QTKMLY |
TOPO_DOM /note="Lumenal" REGION /note="HD3" TOPO_DOM /note="Lumenal" REGION /note="HD3" | ||
3658 | D | - | - | - | - | GDTE |
TRANSMEM /note="Helical" REGION /note="HD3" TRANSMEM /note="Helical" REGION /note="HD3" | ||
3659 | C | - | - | - | - | CLVEMFI |
TRANSMEM /note="Helical" REGION /note="HD3" TRANSMEM /note="Helical" REGION /note="HD3" | ||
3660 | V | - | - | - | - | VLYGM |
TRANSMEM /note="Helical" REGION /note="HD3" TRANSMEM /note="Helical" REGION /note="HD3" | ||
3661 | M | - | - | - | - | MNLIVF |
TRANSMEM /note="Helical" REGION /note="HD3" TRANSMEM /note="Helical" REGION /note="HD3" | ||
3662 | Y | - | - | - | - | YINATV |
TRANSMEM /note="Helical" REGION /note="HD3" TRANSMEM /note="Helical" REGION /note="HD3" | ||
3663 | A | - | - | - | - | SGLAFIV |
TRANSMEM /note="Helical" REGION /note="HD3" TRANSMEM /note="Helical" REGION /note="HD3" | ||
3664 | S | - | - | - | - | VSFILCM |
TRANSMEM /note="Helical" REGION /note="HD3" TRANSMEM /note="Helical" REGION /note="HD3" | ||
3665 | A | - | - | - | - | CANLVMI |
TRANSMEM /note="Helical" REGION /note="HD3" TRANSMEM /note="Helical" REGION /note="HD3" | ||
3666 | L | - | - | - | - | LCTFVS |
TRANSMEM /note="Helical" REGION /note="HD3" TRANSMEM /note="Helical" REGION /note="HD3" | ||
3667 | V | - | - | - | - | VFSLTI |
TRANSMEM /note="Helical" REGION /note="HD3" TRANSMEM /note="Helical" REGION /note="HD3" | ||
3668 | L | - | - | - | - | VLAFI |
TRANSMEM /note="Helical" REGION /note="HD3" TRANSMEM /note="Helical" REGION /note="HD3" | ||
3669 | L | - | - | - | - | LMAFTV |
TRANSMEM /note="Helical" REGION /note="HD3" TRANSMEM /note="Helical" REGION /note="HD3" | ||
3670 | I | - | - | - | - | VIMLAFG |
TRANSMEM /note="Helical" REGION /note="HD3" TRANSMEM /note="Helical" REGION /note="HD3" | ||
3671 | L | - | - | - | - | LFITVAG |
TRANSMEM /note="Helical" REGION /note="HD3" TRANSMEM /note="Helical" REGION /note="HD3" | ||
3672 | M | - | - | - | - | VHYMCIAGL |
TRANSMEM /note="Helical" REGION /note="HD3" TRANSMEM /note="Helical" REGION /note="HD3" | ||
3673 | T | - | - | - | - | TQSVG |
TRANSMEM /note="Helical" REGION /note="HD3" TRANSMEM /note="Helical" REGION /note="HD3" | ||
3674 | A | - | - | - | - | AMVWFIKRTLDEGNPQS |
TRANSMEM /note="Helical" REGION /note="HD3" TRANSMEM /note="Helical" REGION /note="HD3" | ||
3675 | R | - | - | - | - | RYHADEGIKLNPQSTV |
TRANSMEM /note="Helical" REGION /note="HD3" TRANSMEM /note="Helical" REGION /note="HD3" | ||
3676 | T | - | - | - | - | STFLMADEGIKNPQRVY |
TRANSMEM /note="Helical" REGION /note="HD3" TRANSMEM /note="Helical" REGION /note="HD3" | ||
3677 | V | - | - | - | - | VIFYASWLDEGKNPQRT |
TRANSMEM /note="Helical" REGION /note="HD3" TRANSMEM /note="Helical" REGION /note="HD3" | ||
3678 | Y | - | - | - | - | FNYRKL |
TRANSMEM /note="Helical" REGION /note="HD3" TRANSMEM /note="Helical" REGION /note="HD3" | ||
3679 | D | - | - | - | - | HDEPMTVLNS |
TOPO_DOM /note="Cytoplasmic" REGION /note="HD3" TOPO_DOM /note="Cytoplasmic" REGION /note="HD3" | ||
3680 | D | - | - | - | - | DKRLNQST |
TOPO_DOM /note="Cytoplasmic" REGION /note="HD3" TOPO_DOM /note="Cytoplasmic" REGION /note="HD3" | ||
3681 | A | - | - | - | - | ALFTVCPIG |
TOPO_DOM /note="Cytoplasmic" REGION /note="HD3" TOPO_DOM /note="Cytoplasmic" REGION /note="HD3" | ||
3682 | A | - | - | - | - | AFGTSYCP |
TOPO_DOM /note="Cytoplasmic" REGION /note="HD3" TOPO_DOM /note="Cytoplasmic" REGION /note="HD3" | ||
3683 | R | - | - | - | - | SNRFHKT |
TOPO_DOM /note="Cytoplasmic" REGION /note="HD3" TOPO_DOM /note="Cytoplasmic" REGION /note="HD3" | ||
3684 | R | - | - | - | - | RVWFLTKQSI |
TOPO_DOM /note="Cytoplasmic" REGION /note="HD3" TOPO_DOM /note="Cytoplasmic" REGION /note="HD3" | ||
3685 | V | - | - | - | - | IVMACFS |
TOPO_DOM /note="Cytoplasmic" REGION /note="HD3" TOPO_DOM /note="Cytoplasmic" REGION /note="HD3" | ||
3686 | W | - | - | - | - | WFTYLM |
TOPO_DOM /note="Cytoplasmic" REGION /note="HD3" TOPO_DOM /note="Cytoplasmic" REGION /note="HD3" | ||
3687 | T | - | - | - | - | TYLAFSV |
TOPO_DOM /note="Cytoplasmic" REGION /note="HD3" TOPO_DOM /note="Cytoplasmic" REGION /note="HD3" | ||
3688 | L | - | - | - | - | VLSM |
TOPO_DOM /note="Cytoplasmic" REGION /note="HD3" TOPO_DOM /note="Cytoplasmic" REGION /note="HD3" | ||
3689 | M | - | - | - | - | GCMSFVL |
TOPO_DOM /note="Cytoplasmic" REGION /note="HD3" TOPO_DOM /note="Cytoplasmic" REGION /note="HD3" | ||
3690 | N | - | - | - | - | NSRAT |
TOPO_DOM /note="Cytoplasmic" REGION /note="HD3" TOPO_DOM /note="Cytoplasmic" REGION /note="HD3" | ||
3691 | V | - | - | - | - | VLATIG |
TOPO_DOM /note="Cytoplasmic" REGION /note="HD3" TOPO_DOM /note="Cytoplasmic" REGION /note="HD3" | ||
3692 | I | - | - | - | - | VILMT |
TOPO_DOM /note="Cytoplasmic" REGION /note="HD3" TOPO_DOM /note="Cytoplasmic" REGION /note="HD3" | ||
3693 | T | - | - | - | - | TSAGKMV |
TOPO_DOM /note="Cytoplasmic" REGION /note="HD3" TOPO_DOM /note="Cytoplasmic" REGION /note="HD3" | ||
3694 | L | - | - | - | - | LVAWI |
TOPO_DOM /note="Cytoplasmic" REGION /note="HD3" TOPO_DOM /note="Cytoplasmic" REGION /note="HD3" | ||
3695 | V | - | - | - | - | LVYAFI |
TOPO_DOM /note="Cytoplasmic" REGION /note="HD3" TOPO_DOM /note="Cytoplasmic" REGION /note="HD3" | ||
3696 | Y | - | - | - | - | YSTGV |
TOPO_DOM /note="Cytoplasmic" REGION /note="HD3" TOPO_DOM /note="Cytoplasmic" REGION /note="HD3" | ||
3697 | K | - | - | - | - | TMKENL |
TOPO_DOM /note="Cytoplasmic" REGION /note="HD3" TOPO_DOM /note="Cytoplasmic" REGION /note="HD3" | ||
3698 | V | - | - | - | - | YVWACIDEGKLNPQRST |
TOPO_DOM /note="Cytoplasmic" REGION /note="HD3" TOPO_DOM /note="Cytoplasmic" REGION /note="HD3" | ||
3699 | Y | - | - | - | - | YFLSWGKTADEINPQRV |
TOPO_DOM /note="Cytoplasmic" REGION /note="HD3" TOPO_DOM /note="Cytoplasmic" REGION /note="HD3" | ||
3700 | Y | - | - | - | - | YFTIEMADGKLNPQRSV |
TOPO_DOM /note="Cytoplasmic" REGION /note="HD3" TOPO_DOM /note="Cytoplasmic" REGION /note="HD3" | ||
3701 | G | - | - | - | - | GSAFPL |
TOPO_DOM /note="Cytoplasmic" REGION /note="HD3" TOPO_DOM /note="Cytoplasmic" REGION /note="HD3" | ||
3702 | N | - | - | - | - | NSDGAEWYL |
TOPO_DOM /note="Cytoplasmic" REGION /note="HD3" TOPO_DOM /note="Cytoplasmic" REGION /note="HD3" | ||
3703 | A | - | - | - | - | ANTSDICEGLVFHKMPQRY |
TOPO_DOM /note="Cytoplasmic" REGION /note="HD3" TOPO_DOM /note="Cytoplasmic" REGION /note="HD3" | ||
3704 | L | - | - | - | - | LDSFAGEIKNPQRTVCHMY |
TOPO_DOM /note="Cytoplasmic" REGION /note="HD3" TOPO_DOM /note="Cytoplasmic" REGION /note="HD3" | ||
3705 | D | - | - | - | - | DESLTAGVFHIKMNPQRY |
TOPO_DOM /note="Cytoplasmic" REGION /note="HD3" TOPO_DOM /note="Cytoplasmic" REGION /note="HD3" | ||
3706 | Q | - | - | - | - | ESQVDCHLAFGIKNPRTY |
TOPO_DOM /note="Cytoplasmic" REGION /note="HD3" TOPO_DOM /note="Cytoplasmic" REGION /note="HD3" | ||
3707 | A | - | - | - | - | APELSYDGIKNQRTV |
TOPO_DOM /note="Cytoplasmic" REGION /note="HD3" TOPO_DOM /note="Cytoplasmic" REGION /note="HD3" | ||
3708 | I | - | - | - | - | IVLTMADEGKNPQRS |
TOPO_DOM /note="Cytoplasmic" REGION /note="HD3" TOPO_DOM /note="Cytoplasmic" REGION /note="HD3" | ||
3709 | S | - | - | - | - | SLNTADVEGIKPQR |
TOPO_DOM /note="Cytoplasmic" REGION /note="HD3" TOPO_DOM /note="Cytoplasmic" REGION /note="HD3" | ||
3710 | M | - | - | - | - | MLYVADEGIKNPQRST |
TOPO_DOM /note="Cytoplasmic" REGION /note="HD3" TOPO_DOM /note="Cytoplasmic" REGION /note="HD3" | ||
3711 | W | - | - | - | - | LWF |
TOPO_DOM /note="Cytoplasmic" REGION /note="HD3" TOPO_DOM /note="Cytoplasmic" REGION /note="HD3" | ||
3712 | A | - | - | - | - | ATEVGLMIDFKNPQRS |
TOPO_DOM /note="Cytoplasmic" REGION /note="HD3" TOPO_DOM /note="Cytoplasmic" REGION /note="HD3" | ||
3713 | L | - | - | - | - | LMFCTADEGIKNPQRSVY |
TOPO_DOM /note="Cytoplasmic" REGION /note="HD3" TOPO_DOM /note="Cytoplasmic" REGION /note="HD3" | ||
3714 | V | - | - | - | - | LVIFAM |
TOPO_DOM /note="Cytoplasmic" REGION /note="HD3" TOPO_DOM /note="Cytoplasmic" REGION /note="HD3" | ||
3715 | I | - | - | - | - | ITFLVA |
TOPO_DOM /note="Cytoplasmic" REGION /note="HD3" TOPO_DOM /note="Cytoplasmic" REGION /note="HD3" | ||
3716 | S | - | - | - | - | STECL |
TOPO_DOM /note="Cytoplasmic" REGION /note="HD3" TOPO_DOM /note="Cytoplasmic" REGION /note="HD3" | ||
3717 | V | - | - | - | - | LVASG |
TOPO_DOM /note="Cytoplasmic" REGION /note="HD3" TOPO_DOM /note="Cytoplasmic" REGION /note="HD3" | ||
3718 | T | - | - | - | - | TFVIMS |
TOPO_DOM /note="Cytoplasmic" REGION /note="HD3" TOPO_DOM /note="Cytoplasmic" REGION /note="HD3" | ||
3719 | S | - | - | - | - | SGTHDY |
TOPO_DOM /note="Cytoplasmic" REGION /note="HD3" TOPO_DOM /note="Cytoplasmic" REGION /note="HD3" | ||
3720 | N | - | - | - | - | NTDKGW |
TOPO_DOM /note="Cytoplasmic" REGION /note="HD3" TOPO_DOM /note="Cytoplasmic" REGION /note="HD3" | ||
3721 | Y | - | - | - | - | YDWEFIT |
TOPO_DOM /note="Cytoplasmic" REGION /note="HD3" TOPO_DOM /note="Cytoplasmic" REGION /note="HD3" | ||
3722 | S | - | - | - | - | TWSVIADEFGKLNPQRY |
TOPO_DOM /note="Cytoplasmic" REGION /note="HD3" TOPO_DOM /note="Cytoplasmic" REGION /note="HD3" | ||
3723 | G | - | - | - | - | GWLVYFIMADEKNPQRST |
TOPO_DOM /note="Cytoplasmic" REGION /note="HD3" TOPO_DOM /note="Cytoplasmic" REGION /note="HD3" | ||
3724 | V | - | - | - | - | VATFIGLDEKNPQRSY |
TOPO_DOM /note="Cytoplasmic" REGION /note="HD3" TOPO_DOM /note="Cytoplasmic" REGION /note="HD3" | ||
3725 | V | - | - | - | - | VNAGITLDEFKPQRSY |
TOPO_DOM /note="Cytoplasmic" REGION /note="HD3" TOPO_DOM /note="Cytoplasmic" REGION /note="HD3" | ||
3726 | T | - | - | - | - | TFVACGIL |
TOPO_DOM /note="Cytoplasmic" REGION /note="HD3" TOPO_DOM /note="Cytoplasmic" REGION /note="HD3" | ||
3727 | T | - | - | - | - | TASLINV |
TOPO_DOM /note="Cytoplasmic" REGION /note="HD3" TOPO_DOM /note="Cytoplasmic" REGION /note="HD3" | ||
3728 | I | - | - | - | - | SIVMATY |
TRANSMEM /note="Helical" REGION /note="HD3" TRANSMEM /note="Helical" REGION /note="HD3" | ||
3729 | M | - | - | - | - | LMNFVYCW |
TRANSMEM /note="Helical" REGION /note="HD3" TRANSMEM /note="Helical" REGION /note="HD3" | ||
3730 | F | - | - | - | - | SFRYNKA |
TRANSMEM /note="Helical" REGION /note="HD3" TRANSMEM /note="Helical" REGION /note="HD3" | ||
3731 | L | - | - | - | - | LIAV |
TRANSMEM /note="Helical" REGION /note="HD3" TRANSMEM /note="Helical" REGION /note="HD3" | ||
3732 | A | - | - | - | - | AICGSL |
TRANSMEM /note="Helical" REGION /note="HD3" TRANSMEM /note="Helical" REGION /note="HD3" | ||
3733 | R | - | - | - | - | RKTGYQI |
TRANSMEM /note="Helical" REGION /note="HD3" TRANSMEM /note="Helical" REGION /note="HD3" | ||
3734 | A | - | - | - | - | ALVFYG |
TRANSMEM /note="Helical" REGION /note="HD3" TRANSMEM /note="Helical" REGION /note="HD3" | ||
3735 | I | - | - | - | - | IFKMACTV |
TRANSMEM /note="Helical" REGION /note="HD3" TRANSMEM /note="Helical" REGION /note="HD3" | ||
3736 | V | - | - | - | - | VATY |
TRANSMEM /note="Helical" REGION /note="HD3" TRANSMEM /note="Helical" REGION /note="HD3" | ||
3737 | F | - | - | - | - | FYWIKRVAL |
TRANSMEM /note="Helical" REGION /note="HD3" TRANSMEM /note="Helical" REGION /note="HD3" | ||
3738 | V | - | - | - | - | VAKLMFYN |
TRANSMEM /note="Helical" REGION /note="HD3" TRANSMEM /note="Helical" REGION /note="HD3" | ||
3739 | C | - | - | - | - | CAVKLIPSW |
TRANSMEM /note="Helical" REGION /note="HD3" TRANSMEM /note="Helical" REGION /note="HD3" | ||
3740 | V | - | - | - | - | VAFLWKMPT |
TRANSMEM /note="Helical" REGION /note="HD3" TRANSMEM /note="Helical" REGION /note="HD3" | ||
3741 | E | - | - | - | - | ELKFAQRYSN |
TRANSMEM /note="Helical" REGION /note="HD3" TRANSMEM /note="Helical" REGION /note="HD3" | ||
3742 | Y | - | - | - | - | YVALSFDEGIKNPRT |
TRANSMEM /note="Helical" REGION /note="HD3" TRANSMEM /note="Helical" REGION /note="HD3" | ||
3743 | Y | - | - | - | - | YVCDALPSMNEFGIKQRT |
TRANSMEM /note="Helical" REGION /note="HD3" TRANSMEM /note="Helical" REGION /note="HD3" | ||
3744 | P | - | - | - | - | PNCSTIADEGKLRV |
TRANSMEM /note="Helical" REGION /note="HD3" TRANSMEM /note="Helical" REGION /note="HD3" | ||
3745 | L | - | - | - | - | LASVFNTHQYI |
TRANSMEM /note="Helical" REGION /note="HD3" TRANSMEM /note="Helical" REGION /note="HD3" | ||
3746 | L | - | - | - | - | LAFVYIT |
TRANSMEM /note="Helical" REGION /note="HD3" TRANSMEM /note="Helical" REGION /note="HD3" | ||
3747 | F | - | - | - | - | FYLTAGV |
TRANSMEM /note="Helical" REGION /note="HD3" TRANSMEM /note="Helical" REGION /note="HD3" | ||
3748 | I | - | - | - | - | FILTYDQSV |
TRANSMEM /note="Helical" REGION /note="HD3" TRANSMEM /note="Helical" REGION /note="HD3" | ||
3749 | T | - | - | - | - | TDLSVNFI |
TOPO_DOM /note="Lumenal" REGION /note="HD3" TOPO_DOM /note="Lumenal" REGION /note="HD3" | ||
3750 | G | - | - | - | - | FGDNYVIL |
TOPO_DOM /note="Lumenal" REGION /note="HD3" TOPO_DOM /note="Lumenal" REGION /note="HD3" | ||
3751 | N | - | - | - | - | PGNDY |
TOPO_DOM /note="Lumenal" REGION /note="HD3" TOPO_DOM /note="Lumenal" REGION /note="HD3" | ||
3752 | T | - | - | - | - | TQEFYGRVADL |
TOPO_DOM /note="Lumenal" REGION /note="HD3" TOPO_DOM /note="Lumenal" REGION /note="HD3" | ||
3753 | L | - | - | - | - | VILFM |
TOPO_DOM /note="Lumenal" REGION /note="HD3" TOPO_DOM /note="Lumenal" REGION /note="HD3" | ||
3754 | Q | - | - | - | - | KQRLM |
TOPO_DOM /note="Lumenal" REGION /note="HD3" TOPO_DOM /note="Lumenal" REGION /note="HD3" | ||
3755 | C | - | - | - | - | CLAMSTI |
TOPO_DOM /note="Lumenal" REGION /note="HD3" TOPO_DOM /note="Lumenal" REGION /note="HD3" | ||
3756 | I | - | - | - | - | VIAT |
TRANSMEM /note="Helical" REGION /note="HD3" TRANSMEM /note="Helical" REGION /note="HD3" | ||
3757 | M | - | - | - | - | LMVS |
TRANSMEM /note="Helical" REGION /note="HD3" TRANSMEM /note="Helical" REGION /note="HD3" | ||
3758 | L | - | - | - | - | LVFIM |
TRANSMEM /note="Helical" REGION /note="HD3" TRANSMEM /note="Helical" REGION /note="HD3" | ||
3759 | V | - | - | - | - | VCSLFIM |
TRANSMEM /note="Helical" REGION /note="HD3" TRANSMEM /note="Helical" REGION /note="HD3" | ||
3760 | Y | - | - | - | - | YNL |
TRANSMEM /note="Helical" REGION /note="HD3" TRANSMEM /note="Helical" REGION /note="HD3" | ||
3761 | C | - | - | - | - | LCMNT |
TRANSMEM /note="Helical" REGION /note="HD3" TRANSMEM /note="Helical" REGION /note="HD3" | ||
3762 | F | - | - | - | - | FLACGIV |
TRANSMEM /note="Helical" REGION /note="HD3" TRANSMEM /note="Helical" REGION /note="HD3" | ||
3763 | L | - | - | - | - | LICV |
TRANSMEM /note="Helical" REGION /note="HD3" TRANSMEM /note="Helical" REGION /note="HD3" | ||
3764 | G | - | - | - | - | G |
TRANSMEM /note="Helical" REGION /note="HD3" TRANSMEM /note="Helical" REGION /note="HD3" | ||
3765 | Y | - | - | - | - | YWF |
TRANSMEM /note="Helical" REGION /note="HD3" TRANSMEM /note="Helical" REGION /note="HD3" | ||
3766 | C | - | - | - | - | LCVFIM |
TRANSMEM /note="Helical" REGION /note="HD3" TRANSMEM /note="Helical" REGION /note="HD3" | ||
3767 | C | - | - | - | - | CFNSTVIL |
TRANSMEM /note="Helical" REGION /note="HD3" TRANSMEM /note="Helical" REGION /note="HD3" | ||
3768 | C | - | - | - | - | CTS |
TRANSMEM /note="Helical" REGION /note="HD3" TRANSMEM /note="Helical" REGION /note="HD3" | ||
3769 | C | - | - | - | - | CVMT |
TRANSMEM /note="Helical" REGION /note="HD3" TRANSMEM /note="Helical" REGION /note="HD3" | ||
3770 | Y | - | - | - | - | YF |
TRANSMEM /note="Helical" REGION /note="HD3" TRANSMEM /note="Helical" REGION /note="HD3" | ||
3771 | F | - | - | - | - | FYW |
TRANSMEM /note="Helical" REGION /note="HD3" TRANSMEM /note="Helical" REGION /note="HD3" | ||
3772 | G | - | - | - | - | G |
TRANSMEM /note="Helical" REGION /note="HD3" TRANSMEM /note="Helical" REGION /note="HD3" | ||
3773 | L | - | - | - | - | LIVSF |
TRANSMEM /note="Helical" REGION /note="HD3" TRANSMEM /note="Helical" REGION /note="HD3" | ||
3774 | F | - | - | - | - | LFY |
TRANSMEM /note="Helical" REGION /note="HD3" TRANSMEM /note="Helical" REGION /note="HD3" | ||
3775 | C | - | - | - | - | YSCWN |
TRANSMEM /note="Helical" REGION /note="HD3" TRANSMEM /note="Helical" REGION /note="HD3" | ||
3776 | L | - | - | - | - | LW |
TRANSMEM /note="Helical" REGION /note="HD3" TRANSMEM /note="Helical" REGION /note="HD3" | ||
3777 | L | - | - | - | - | LVIFM |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
3778 | N | - | - | - | - | N |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
3779 | R | - | - | - | - | RSKL |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
3780 | Y | - | - | - | - | FVYKLI |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
3781 | F | - | - | - | - | FCLT |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
3782 | R | - | - | - | - | RKGC |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
3783 | L | - | - | - | - | LMCVA |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
3784 | T | - | - | - | - | TPS |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
3785 | L | - | - | - | - | LMCV |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
3786 | G | - | - | - | - | G |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
3787 | V | - | - | - | - | VKNC |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
3788 | Y | - | - | - | - | Y |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
3789 | D | - | - | - | - | DNEQ |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
3790 | Y | - | - | - | - | YF |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
3791 | L | - | - | - | - | KTLVC |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
3792 | V | - | - | - | - | VI |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
3793 | S | - | - | - | - | S |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
3794 | T | - | - | - | - | VTAPS |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
3795 | Q | - | - | - | - | QAD |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
3796 | E | - | - | - | - | EQ |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
3797 | F | - | - | - | - | FLY |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
3798 | R | - | - | - | - | RK |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
3799 | Y | - | - | - | - | YF |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
3800 | M | - | - | - | - | ML |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
3801 | N | - | - | - | - | NVTC |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
3802 | S | - | - | - | - | ASLG |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
3803 | Q | - | - | - | - | NHQ |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
3804 | G | - | - | - | - | GNK |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
3805 | L | - | - | - | - | LIV |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
3806 | L | - | - | - | - | RLNHST |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
3807 | P | - | - | - | - | PA |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
3808 | P | - | - | - | - | P |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
3809 | K | - | - | - | - | KRTHN |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
3810 | S | - | - | - | - | NGTS |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
3811 | S | - | - | - | - | SVPAT |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
3812 | I | - | - | - | - | FWIYL |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
3813 | D | - | - | - | - | DEQ |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
3814 | A | - | - | - | - | AVS |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
3815 | F | - | - | - | - | LFMI |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
3816 | K | - | - | - | - | MIKLAFRSTWV |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
3817 | L | - | - | - | - | LT |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
3818 | N | - | - | - | - | NS |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
3819 | I | - | - | - | - | FIALM |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
3820 | K | - | - | - | - | KL |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
3821 | L | - | - | - | - | LI |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
3822 | L | - | - | - | - | LIQMA |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
3823 | G | - | - | - | - | G |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
3824 | I | - | - | - | - | IV |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
3825 | G | - | - | - | - | G |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
3826 | G | - | - | - | - | G |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
3827 | K | - | - | - | - | KDVTIEGPR |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
3828 | P | - | - | - | - | PRK |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
3829 | C | - | - | - | - | CVNTI |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
3830 | I | - | - | - | - | ILY |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
3831 | K | - | - | - | - | KEPR |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
3832 | V | - | - | - | - | VI |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
3833 | A | - | - | - | - | SA |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
3834 | T | - | - | - | - | TQSA |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
3835 | V | - | - | - | - | VIMF |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
3836 | Q | - | - | - | - | Q |
SITE /note="Cleavage; by 3CL-PRO" ECO:0000269|PubMed:32083638" TOPO_DOM /note="Cytoplasmic" SITE /note="Cleavage; by 3CL-PRO" ECO:0000269|PubMed:32083638" TOPO_DOM /note="Cytoplasmic" | ||
3837 | S | - | - | - | - | SA |
SITE /note="Cleavage; by 3CL-PRO" ECO:0000269|PubMed:32083638" DOMAIN /note="RdRp Nsp7 cofactor" TOPO_DOM /note="Cytoplasmic" SITE /note="Cleavage; by 3CL-PRO" ECO:0000269|PubMed:32083638" DOMAIN /note="RdRp Nsp7 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
3838 | K | - | - | - | - | KRN |
DOMAIN /note="RdRp Nsp7 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp7 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
3839 | M | - | - | - | - | LM |
DOMAIN /note="RdRp Nsp7 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp7 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
3840 | S | - | - | - | - | TS |
DOMAIN /note="RdRp Nsp7 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp7 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
3841 | D | - | - | - | - | DE |
DOMAIN /note="RdRp Nsp7 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp7 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
3842 | V | - | - | - | - | VLMI |
DOMAIN /note="RdRp Nsp7 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp7 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
3843 | K | - | - | - | - | K |
DOMAIN /note="RdRp Nsp7 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp7 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
3844 | C | - | - | - | - | C |
DOMAIN /note="RdRp Nsp7 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp7 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
3845 | T | - | - | - | - | TASV |
DOMAIN /note="RdRp Nsp7 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp7 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
3846 | S | - | - | - | - | NST |
DOMAIN /note="RdRp Nsp7 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp7 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
3847 | V | - | - | - | - | V |
DOMAIN /note="RdRp Nsp7 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp7 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
3848 | V | - | - | - | - | V |
DOMAIN /note="RdRp Nsp7 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp7 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
3849 | L | - | - | - | - | L |
DOMAIN /note="RdRp Nsp7 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp7 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
3850 | L | - | - | - | - | LM |
DOMAIN /note="RdRp Nsp7 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp7 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
3851 | S | - | - | - | - | GSNQ |
DOMAIN /note="RdRp Nsp7 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp7 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
3852 | V | - | - | - | - | CVLI |
DOMAIN /note="RdRp Nsp7 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp7 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
3853 | L | - | - | - | - | L |
DOMAIN /note="RdRp Nsp7 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp7 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
3854 | Q | - | - | - | - | QST |
DOMAIN /note="RdRp Nsp7 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp7 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
3855 | Q | - | - | - | - | QKHNS |
DOMAIN /note="RdRp Nsp7 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp7 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
3856 | L | - | - | - | - | LM |
DOMAIN /note="RdRp Nsp7 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp7 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
3857 | R | - | - | - | - | HNR |
DOMAIN /note="RdRp Nsp7 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp7 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
3858 | V | - | - | - | - | VIL |
DOMAIN /note="RdRp Nsp7 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp7 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
3859 | E | - | - | - | - | EAS |
DOMAIN /note="RdRp Nsp7 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp7 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
3860 | S | - | - | - | - | SA |
DOMAIN /note="RdRp Nsp7 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp7 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
3861 | S | - | - | - | - | NS |
DOMAIN /note="RdRp Nsp7 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp7 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
3862 | S | - | - | - | - | S |
DOMAIN /note="RdRp Nsp7 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp7 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
3863 | K | - | - | - | - | KRST |
DOMAIN /note="RdRp Nsp7 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp7 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
3864 | L | - | - | - | - | LEMA |
DOMAIN /note="RdRp Nsp7 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp7 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
3865 | W | - | - | - | - | WH |
DOMAIN /note="RdRp Nsp7 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp7 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
3866 | A | - | - | - | - | AQNV |
DOMAIN /note="RdRp Nsp7 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp7 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
3867 | Q | - | - | - | - | YQLFH |
DOMAIN /note="RdRp Nsp7 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp7 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
3868 | C | - | - | - | - | CL |
DOMAIN /note="RdRp Nsp7 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp7 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
3869 | V | - | - | - | - | VS |
DOMAIN /note="RdRp Nsp7 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp7 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
3870 | Q | - | - | - | - | EDKQTGI |
DOMAIN /note="RdRp Nsp7 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp7 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
3871 | L | - | - | - | - | LCM |
DOMAIN /note="RdRp Nsp7 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp7 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
3872 | H | - | - | - | - | H |
DOMAIN /note="RdRp Nsp7 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp7 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
3873 | N | - | - | - | - | N |
DOMAIN /note="RdRp Nsp7 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp7 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
3874 | D | - | - | - | - | EKD |
DOMAIN /note="RdRp Nsp7 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp7 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
3875 | I | - | - | - | - | I |
DOMAIN /note="RdRp Nsp7 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp7 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
3876 | L | - | - | - | - | LN |
DOMAIN /note="RdRp Nsp7 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp7 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
3877 | L | - | - | - | - | LAS |
DOMAIN /note="RdRp Nsp7 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp7 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
3878 | A | - | - | - | - | CAST |
DOMAIN /note="RdRp Nsp7 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp7 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
3879 | K | - | - | - | - | DNSKT |
DOMAIN /note="RdRp Nsp7 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp7 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
3880 | D | - | - | - | - | DS |
DOMAIN /note="RdRp Nsp7 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp7 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
3881 | T | - | - | - | - | PLTVA |
DOMAIN /note="RdRp Nsp7 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp7 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
3882 | T | - | - | - | - | ETSGD |
DOMAIN /note="RdRp Nsp7 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp7 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
3883 | E | - | - | - | - | EVKAITM |
DOMAIN /note="RdRp Nsp7 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp7 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
3884 | A | - | - | - | - | ACV |
DOMAIN /note="RdRp Nsp7 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp7 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
3885 | F | - | - | - | - | FQML |
DOMAIN /note="RdRp Nsp7 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp7 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
3886 | E | - | - | - | - | EDS |
DOMAIN /note="RdRp Nsp7 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp7 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
3887 | K | - | - | - | - | KMNAL |
DOMAIN /note="RdRp Nsp7 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp7 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
3888 | M | - | - | - | - | LFM |
DOMAIN /note="RdRp Nsp7 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp7 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
3889 | V | - | - | - | - | LVA |
DOMAIN /note="RdRp Nsp7 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp7 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
3890 | S | - | - | - | - | ASQGC |
DOMAIN /note="RdRp Nsp7 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp7 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
3891 | L | - | - | - | - | LM |
DOMAIN /note="RdRp Nsp7 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp7 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
3892 | L | - | - | - | - | LFI |
DOMAIN /note="RdRp Nsp7 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp7 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
3893 | S | - | - | - | - | ASIV |
DOMAIN /note="RdRp Nsp7 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp7 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
3894 | V | - | - | - | - | VFT |
DOMAIN /note="RdRp Nsp7 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp7 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
3895 | L | - | - | - | - | LF |
DOMAIN /note="RdRp Nsp7 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp7 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
3896 | L | - | - | - | - | LFM |
DOMAIN /note="RdRp Nsp7 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp7 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
3897 | S | - | - | - | - | SACT |
DOMAIN /note="RdRp Nsp7 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp7 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
3898 | M | - | - | - | - | KNMIFL |
DOMAIN /note="RdRp Nsp7 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp7 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
3899 | Q | - | - | - | - | PHQDNS |
DOMAIN /note="RdRp Nsp7 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp7 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
3900 | G | - | - | - | - | SGAN |
DOMAIN /note="RdRp Nsp7 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp7 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
3901 | A | - | - | - | - | ATDN |
DOMAIN /note="RdRp Nsp7 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp7 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
3902 | V | - | - | - | - | VFIC |
DOMAIN /note="RdRp Nsp7 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp7 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
3903 | D | - | - | - | - | DGN |
DOMAIN /note="RdRp Nsp7 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp7 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
3904 | I | - | - | - | - | LIV |
DOMAIN /note="RdRp Nsp7 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp7 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
3905 | N | - | - | - | - | DESNG |
DOMAIN /note="RdRp Nsp7 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp7 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
3906 | R | - | - | - | - | EDKAGR |
DOMAIN /note="RdRp Nsp7 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp7 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
3907 | L | - | - | - | - | LVY |
DOMAIN /note="RdRp Nsp7 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp7 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
3908 | C | - | - | - | - | CISLAV |
DOMAIN /note="RdRp Nsp7 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp7 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
3909 | E | - | - | - | - | DES |
DOMAIN /note="RdRp Nsp7 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp7 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
3910 | E | - | - | - | - | DSE |
DOMAIN /note="RdRp Nsp7 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp7 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
3911 | M | - | - | - | - | YIML |
DOMAIN /note="RdRp Nsp7 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp7 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
3912 | L | - | - | - | - | FLVA |
DOMAIN /note="RdRp Nsp7 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp7 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
3913 | D | - | - | - | - | DEKNRQ |
DOMAIN /note="RdRp Nsp7 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp7 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
3914 | N | - | - | - | - | NDRHT |
DOMAIN /note="RdRp Nsp7 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp7 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
3915 | R | - | - | - | - | SNRPTD |
DOMAIN /note="RdRp Nsp7 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp7 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
3916 | A | - | - | - | - | TSA |
DOMAIN /note="RdRp Nsp7 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp7 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
3917 | T | - | - | - | - | VTIM |
DOMAIN /note="RdRp Nsp7 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp7 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
3918 | L | - | - | - | - | L |
DOMAIN /note="RdRp Nsp7 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp7 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
3919 | Q | - | - | - | - | Q |
SITE /note="Cleavage; by 3CL-PRO" ECO:0000269|PubMed:32083638" DOMAIN /note="RdRp Nsp7 cofactor" TOPO_DOM /note="Cytoplasmic" SITE /note="Cleavage; by 3CL-PRO" ECO:0000269|PubMed:32083638" DOMAIN /note="RdRp Nsp7 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
3920 | A | - | - | - | - | AS |
SITE /note="Cleavage; by 3CL-PRO" ECO:0000269|PubMed:32083638" DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" SITE /note="Cleavage; by 3CL-PRO" ECO:0000269|PubMed:32083638" DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
3921 | I | - | - | - | - | VLIT |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
3922 | A | - | - | - | - | AQTL |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
3923 | S | - | - | - | - | SQA |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
3924 | E | - | - | - | - | ESTA |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
3925 | F | - | - | - | - | FY |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
3926 | S | - | - | - | - | SVA |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
3927 | S | - | - | - | - | NHSGA |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
3928 | L | - | - | - | - | LMI |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
3929 | P | - | - | - | - | PAS |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
3930 | S | - | - | - | - | ST |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
3931 | Y | - | - | - | - | YFW |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
3932 | A | - | - | - | - | AVIL |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
3933 | A | - | - | - | - | AEDI |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
3934 | Y | - | - | - | - | YLF |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
3935 | A | - | - | - | - | EA |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
3936 | T | - | - | - | - | TNRAKLV |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
3937 | A | - | - | - | - | A |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
3938 | Q | - | - | - | - | RQK |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
3939 | E | - | - | - | - | KQESAN |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
3940 | A | - | - | - | - | ANSDEILQ |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
3941 | Y | - | - | - | - | YL |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
3942 | E | - | - | - | - | EDQA |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
3943 | Q | - | - | - | - | EDKQTN |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
3944 | A | - | - | - | - | AV |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
3945 | V | - | - | - | - | VKLIMR |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
3946 | A | - | - | - | - | ANKSDV |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
3947 | N | - | - | - | - | NSDT |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
3948 | G | - | - | - | - | GD |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
3949 | D | - | - | - | - | SDVA |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
3950 | S | - | - | - | - | SPATN |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
3951 | E | - | - | - | - | PQEAS |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
3952 | V | - | - | - | - | QVS |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
3953 | V | - | - | - | - | VLQEIT |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
3954 | L | - | - | - | - | LIV |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
3955 | K | - | - | - | - | KAN |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
3956 | K | - | - | - | - | QAK |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
3957 | L | - | - | - | - | LY |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
3958 | K | - | - | - | - | KREQT |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
3959 | K | - | - | - | - | KHR |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
3960 | S | - | - | - | - | AS |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
3961 | L | - | - | - | - | MCLAVF |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
3962 | N | - | - | - | - | N |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
3963 | V | - | - | - | - | IV |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
3964 | A | - | - | - | - | A |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
3965 | K | - | - | - | - | K |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
3966 | S | - | - | - | - | SNA |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
3967 | E | - | - | - | - | EAVD |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
3968 | F | - | - | - | - | FYL |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
3969 | D | - | - | - | - | DE |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
3970 | R | - | - | - | - | RKH |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
3971 | D | - | - | - | - | DEN |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
3972 | A | - | - | - | - | AKRLVIS |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
3973 | A | - | - | - | - | AS |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
3974 | M | - | - | - | - | VTM |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
3975 | Q | - | - | - | - | QAT |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
3976 | R | - | - | - | - | RK |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
3977 | K | - | - | - | - | K |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
3978 | L | - | - | - | - | LI |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
3979 | E | - | - | - | - | EDN |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
3980 | K | - | - | - | - | RKS |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
3981 | M | - | - | - | - | M |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
3982 | A | - | - | - | - | AS |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
3983 | D | - | - | - | - | ED |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
3984 | Q | - | - | - | - | QLR |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
3985 | A | - | - | - | - | A |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
3986 | M | - | - | - | - | MAL |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
3987 | T | - | - | - | - | TAS |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
3988 | Q | - | - | - | - | QSNAT |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
3989 | M | - | - | - | - | M |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
3990 | Y | - | - | - | - | Y |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
3991 | K | - | - | - | - | K |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
3992 | Q | - | - | - | - | EQ |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
3993 | A | - | - | - | - | A |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
3994 | R | - | - | - | - | R |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
3995 | S | - | - | - | - | ASIV |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
3996 | E | - | - | - | - | VENT |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
3997 | D | - | - | - | - | DN |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
3998 | K | - | - | - | - | RK |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
3999 | R | - | - | - | - | KR |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
4000 | A | - | - | - | - | SA |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
4001 | K | - | - | - | - | K |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
4002 | V | - | - | - | - | VIL |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
4003 | T | - | - | - | - | VTI |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
4004 | S | - | - | - | - | SA |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
4005 | A | - | - | - | - | AS |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
4006 | M | - | - | - | - | ML |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
4007 | Q | - | - | - | - | QH |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
4008 | T | - | - | - | - | TSA |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
4009 | M | - | - | - | - | ML |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
4010 | L | - | - | - | - | L |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
4011 | F | - | - | - | - | F |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
4012 | T | - | - | - | - | GSTN |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
4013 | M | - | - | - | - | M |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
4014 | L | - | - | - | - | LIV |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
4015 | R | - | - | - | - | RK |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
4016 | K | - | - | - | - | KR |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
4017 | L | - | - | - | - | LI |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
4018 | D | - | - | - | - | D |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
4019 | N | - | - | - | - | NMS |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
4020 | D | - | - | - | - | SDQE |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
4021 | A | - | - | - | - | ASKV |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
4022 | L | - | - | - | - | LV |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
4023 | N | - | - | - | - | NDSE |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
4024 | N | - | - | - | - | TNSVG |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
4025 | I | - | - | - | - | ILV |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
4026 | I | - | - | - | - | LIF |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
4027 | N | - | - | - | - | NDSE |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
4028 | N | - | - | - | - | NQLM |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
4029 | A | - | - | - | - | A |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
4030 | R | - | - | - | - | RVKNS |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
4031 | D | - | - | - | - | NDKS |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
4032 | G | - | - | - | - | G |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
4033 | C | - | - | - | - | VC |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
4034 | V | - | - | - | - | VLI |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
4035 | P | - | - | - | - | P |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
4036 | L | - | - | - | - | L |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
4037 | N | - | - | - | - | SNAG |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
4038 | I | - | - | - | - | VIAT |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
4039 | I | - | - | - | - | IV |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
4040 | P | - | - | - | - | P |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
4041 | L | - | - | - | - | ALISRP |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
4042 | T | - | - | - | - | TVLAC |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
4043 | T | - | - | - | - | SATC |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
4044 | A | - | - | - | - | AS |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
4045 | A | - | - | - | - | NTAS |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
4046 | K | - | - | - | - | KTR |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
4047 | L | - | - | - | - | L |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
4048 | M | - | - | - | - | TMNVRLI |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
4049 | V | - | - | - | - | VIL |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
4050 | V | - | - | - | - | VI |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
4051 | V | - | - | - | - | VITS |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
4052 | P | - | - | - | - | PS |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
4053 | D | - | - | - | - | DNS |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
4054 | Y | - | - | - | - | KILYFPH |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
4055 | G | - | - | - | - | EQDGSTN |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
4056 | T | - | - | - | - | VTSI |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
4057 | Y | - | - | - | - | YFWL |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
4058 | K | - | - | - | - | KDVNST |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
4059 | N | - | - | - | - | KQNAIR |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
4060 | T | - | - | - | - | VTICM |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
4061 | C | - | - | - | - | VCQRIM |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
4062 | D | - | - | - | - | DTERQV |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
4063 | G | - | - | - | - | GENMDWY |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
4064 | N | - | - | - | - | VNGPST |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
4065 | T | - | - | - | - | TYHCNSFV |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
4066 | F | - | - | - | - | VLF |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
4067 | T | - | - | - | - | THNSA |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
4068 | Y | - | - | - | - | Y |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
4069 | A | - | - | - | - | AS |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
4070 | S | - | - | - | - | GSTP |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
4071 | A | - | - | - | - | AVNST |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
4072 | L | - | - | - | - | VLIA |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
4073 | W | - | - | - | - | W |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
4074 | E | - | - | - | - | NDTEHSQ |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
4075 | I | - | - | - | - | IVL |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
4076 | Q | - | - | - | - | QVDMINST |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
4077 | Q | - | - | - | - | QDETSCLVF |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
4078 | V | - | - | - | - | VI |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
4079 | V | - | - | - | - | KQVNAIT |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
4080 | D | - | - | - | - | DN |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
4081 | A | - | - | - | - | ANVS |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
4082 | D | - | - | - | - | DN |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
4083 | S | - | - | - | - | GSN |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
4084 | K | - | - | - | - | KTAERSI |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
4085 | I | - | - | - | - | VINEPTHQ |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
4086 | V | - | - | - | - | VKL |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
4087 | Q | - | - | - | - | HQKN |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
4088 | L | - | - | - | - | LAPVS |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
4089 | S | - | - | - | - | KSTN |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
4090 | E | - | - | - | - | EDS |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
4091 | I | - | - | - | - | IVT |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
4092 | N | - | - | - | - | TGNDSVAEIKLPR |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
4093 | M | - | - | - | - | VAMSKRET |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
4094 | D | - | - | - | - | DEGANQSTL |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
4095 | N | - | - | - | - | NSAGL |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
4096 | S | - | - | - | - | SEGVNTAQ |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
4097 | P | - | - | - | - | ELDPAVQSFGIKNRTY |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
4098 | N | - | - | - | - | NSITDAEGKLPRV |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
4099 | L | - | - | - | - | LICADEGKNPRSTV |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
4100 | A | - | - | - | - | ATSVNDEGIKLPR |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
4101 | W | - | - | - | - | W |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
4102 | P | - | - | - | - | P |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
4103 | L | - | - | - | - | L |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
4104 | I | - | - | - | - | VIKSF |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
4105 | V | - | - | - | - | LVI |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
4106 | T | - | - | - | - | TNEIAGS |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
4107 | A | - | - | - | - | CAL |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
4108 | L | - | - | - | - | ETNLQ |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
4109 | R | - | - | - | - | R |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
4110 | A | - | - | - | - | AHNYGLDEIKPRSTVCFMQ |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
4111 | N | - | - | - | - | NGSTALDEIKPRVCFHMQY |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
4112 | S | - | - | - | - | SHEAGLDIKNPRTVCFMQY |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
4113 | A | - | - | - | - | ATVNIPS |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
4114 | V | - | - | - | - | VTIA |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
4115 | K | - | - | - | - | KVATN |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
4116 | L | - | - | - | - | LM |
DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
4117 | Q | - | - | - | - | Q |
SITE /note="Cleavage; by 3CL-PRO" ECO:0000269|PubMed:32083638" DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" SITE /note="Cleavage; by 3CL-PRO" ECO:0000269|PubMed:32083638" DOMAIN /note="RdRp Nsp8 cofactor" TOPO_DOM /note="Cytoplasmic" | ||
4118 | N | - | - | - | - | N |
SITE /note="Cleavage; by 3CL-PRO" ECO:0000269|PubMed:32083638" DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED SITE /note="Cleavage; by 3CL-PRO" ECO:0000269|PubMed:32083638" DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" | ||
4119 | N | - | - | - | - | N |
DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" | ||
4120 | E | - | - | - | - | E |
DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" | ||
4121 | L | - | - | - | - | LI |
DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" | ||
4122 | S | - | - | - | - | MSIKLR |
DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" | ||
4123 | P | - | - | - | - | P |
DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" | ||
4124 | V | - | - | - | - | GHQSVA |
DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" | ||
4125 | A | - | - | - | - | KGAT |
DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" | ||
4126 | L | - | - | - | - | LVIM |
DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" | ||
4127 | R | - | - | - | - | KR |
DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" | ||
4128 | Q | - | - | - | - | TQERVI |
DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" | ||
4129 | M | - | - | - | - | MKQR |
DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" | ||
4130 | S | - | - | - | - | AVSPN |
DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" | ||
4131 | C | - | - | - | - | VCIMT |
DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" | ||
4132 | A | - | - | - | - | KVNASR |
DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" | ||
4133 | A | - | - | - | - | ASG |
DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" | ||
4134 | G | - | - | - | - | GESL |
DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" | ||
4135 | T | - | - | - | - | VGSTAEIQP |
DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" | ||
4136 | T | - | - | - | - | DTSEG |
DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" | ||
4137 | Q | - | - | - | - | QGMEHIL |
DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" | ||
4138 | T | - | - | - | - | TAGNDI |
DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" | ||
4139 | A | - | - | - | - | ACVHGNI |
DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" | ||
4140 | C | - | - | - | - | CNLTVDEAFGIKPQRS |
DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" | ||
4141 | T | - | - | - | - | TSAVGELDFHIKMNPQRY |
DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" | ||
4142 | D | - | - | - | - | DNVPETFYL |
DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" | ||
4143 | D | - | - | - | - | GDTEI |
DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" | ||
4144 | N | - | - | - | - | SNQPEAGL |
DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" | ||
4145 | A | - | - | - | - | AGKSTDEILPRV |
DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" | ||
4146 | L | - | - | - | - | LKQVAGSDEFHIMNPRTY |
DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" | ||
4147 | A | - | - | - | - | ACLDEFGIKNPQRSTVY |
DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" | ||
4148 | Y | - | - | - | - | YLADEFGIKNPQRSTV |
DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" | ||
4149 | Y | - | - | - | - | YM |
DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" | ||
4150 | N | - | - | - | - | NTAES |
DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" | ||
4151 | N | - | - | - | - | NTSPA |
DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" | ||
4152 | S | - | - | - | - | ETISVGA |
DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" | ||
4153 | K | - | - | - | - | GSKEQN |
DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" | ||
4154 | G | - | - | - | - | GETNSM |
DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" | ||
4155 | G | - | - | - | - | GRKNS |
DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" | ||
4156 | R | - | - | - | - | RKSTA |
DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" | ||
4157 | F | - | - | - | - | FIVMH |
DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" | ||
4158 | V | - | - | - | - | VMLI |
DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" | ||
4159 | L | - | - | - | - | YMLA |
DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" | ||
4160 | A | - | - | - | - | AG |
DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" | ||
4161 | L | - | - | - | - | IFLYV |
DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" | ||
4162 | L | - | - | - | - | LITV |
DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" | ||
4163 | S | - | - | - | - | SAT |
DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" | ||
4164 | D | - | - | - | - | DSENT |
DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" | ||
4165 | H | - | - | - | - | KNHDCVTL |
DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" | ||
4166 | Q | - | - | - | - | PDAQNS |
DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" | ||
4167 | D | - | - | - | - | DGNHY |
DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" | ||
4168 | L | - | - | - | - | LM |
DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" | ||
4169 | K | - | - | - | - | KAR |
DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" | ||
4170 | W | - | - | - | - | YWVF |
DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" | ||
4171 | A | - | - | - | - | AVT |
DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" | ||
4172 | R | - | - | - | - | KRS |
DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" | ||
4173 | F | - | - | - | - | WFIV |
DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" | ||
4174 | P | - | - | - | - | ELPVI |
DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" | ||
4175 | K | - | - | - | - | KNFGSHY |
DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" | ||
4176 | S | - | - | - | - | EDSNKR |
DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" | ||
4177 | D | - | - | - | - | DGANTS |
DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" | ||
4178 | G | - | - | - | - | GADEIKLNPRSTV |
DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" | ||
4179 | T | - | - | - | - | NTCFDSVAEGIKLPR |
DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" | ||
4180 | G | - | - | - | - | GNVCDFAEIKLPQRST |
DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" | ||
4181 | T | - | - | - | - | TVQFAINS |
DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" | ||
4182 | I | - | - | - | - | IV |
DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" | ||
4183 | Y | - | - | - | - | YPILAGSDEKRTVFNQCHMW |
DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" | ||
4184 | T | - | - | - | - | LTVIAGDEKNPRSCFHMQY |
DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" | ||
4185 | E | - | - | - | - | ED |
DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" | ||
4186 | L | - | - | - | - | L |
DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" | ||
4187 | E | - | - | - | - | EDQ |
DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" | ||
4188 | P | - | - | - | - | PAS |
DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" | ||
4189 | P | - | - | - | - | P |
DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" | ||
4190 | C | - | - | - | - | CLR |
DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" | ||
4191 | R | - | - | - | - | KR |
DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" | ||
4192 | F | - | - | - | - | F |
DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" | ||
4193 | V | - | - | - | - | LVSGMYT |
DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" | ||
4194 | T | - | - | - | - | VITM |
DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" | ||
4195 | D | - | - | - | - | DQKEA |
DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" | ||
4196 | T | - | - | - | - | TGDVAS |
DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" | ||
4197 | P | - | - | - | - | PVGA |
DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" | ||
4198 | K | - | - | - | - | KNDSTVR |
DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" | ||
4199 | G | - | - | - | - | GK |
DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" | ||
4200 | P | - | - | - | - | PLVA |
DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" | ||
4201 | K | - | - | - | - | EKQAV |
DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" | ||
4202 | V | - | - | - | - | VIL |
DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" | ||
4203 | K | - | - | - | - | KVR |
DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" | ||
4204 | Y | - | - | - | - | Y |
DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" | ||
4205 | L | - | - | - | - | L |
DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" | ||
4206 | Y | - | - | - | - | YH |
DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" | ||
4207 | F | - | - | - | - | F |
DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" | ||
4208 | I | - | - | - | - | VIT |
DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" | ||
4209 | K | - | - | - | - | KR |
DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" | ||
4210 | G | - | - | - | - | NGS |
DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" | ||
4211 | L | - | - | - | - | LCT |
DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" | ||
4212 | N | - | - | - | - | NRK |
DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" | ||
4213 | N | - | - | - | - | NTS |
DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" | ||
4214 | L | - | - | - | - | LI |
DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" | ||
4215 | N | - | - | - | - | RANVHC |
DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" | ||
4216 | R | - | - | - | - | R |
DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" | ||
4217 | G | - | - | - | - | G |
DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" | ||
4218 | M | - | - | - | - | AMWQT |
DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" | ||
4219 | V | - | - | - | - | VL |
DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" | ||
4220 | L | - | - | - | - | LV |
DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" | ||
4221 | G | - | - | - | - | G |
DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" | ||
4222 | S | - | - | - | - | TYSAFH |
DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" | ||
4223 | L | - | - | - | - | IL |
DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" | ||
4224 | A | - | - | - | - | GAS |
DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" | ||
4225 | A | - | - | - | - | ASNC |
DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" | ||
4226 | T | - | - | - | - | TV |
DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" | ||
4227 | V | - | - | - | - | VI |
DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" | ||
4228 | R | - | - | - | - | RV |
DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" | ||
4229 | L | - | - | - | - | L |
DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" | ||
4230 | Q | - | - | - | - | QH |
SITE /note="Cleavage; by 3CL-PRO" ECO:0000269|PubMed:32083638" DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" SITE /note="Cleavage; by 3CL-PRO" ECO:0000269|PubMed:32083638" DOMAIN /note="Nsp9 ssRNA-binding" TOPO_DOM /note="Cytoplasmic" | ||
4231 | A | - | - | - | - | AS |
SITE /note="Cleavage; by 3CL-PRO" ECO:0000269|PubMed:32083638" DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" SITE /note="Cleavage; by 3CL-PRO" ECO:0000269|PubMed:32083638" DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" | ||
4232 | G | - | - | - | - | G |
DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" | ||
4233 | N | - | - | - | - | KSNTHV |
DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" | ||
4234 | A | - | - | - | - | AQENP |
DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" | ||
4235 | T | - | - | - | - | T |
DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" | ||
4236 | E | - | - | - | - | E |
DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" | ||
4237 | V | - | - | - | - | VYFEQHL |
DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" | ||
4238 | P | - | - | - | - | APV |
DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" | ||
4239 | A | - | - | - | - | SADITV |
DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" | ||
4240 | N | - | - | - | - | NA |
DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" | ||
4241 | S | - | - | - | - | SV |
DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" | ||
4242 | T | - | - | - | - | SGATH |
DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" | ||
4243 | V | - | - | - | - | ILV |
DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" | ||
4244 | L | - | - | - | - | LR |
DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" | ||
4245 | S | - | - | - | - | ST |
DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" | ||
4246 | F | - | - | - | - | LFAH |
DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" | ||
4247 | C | - | - | - | - | CV |
DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" | ||
4248 | A | - | - | - | - | ASNT |
DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" | ||
4249 | F | - | - | - | - | F |
DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" | ||
4250 | A | - | - | - | - | AST |
DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" | ||
4251 | V | - | - | - | - | VP |
DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" | ||
4252 | D | - | - | - | - | D |
DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" | ||
4253 | P | - | - | - | - | PA |
DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" | ||
4254 | A | - | - | - | - | AKEGPQ |
DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" | ||
4255 | K | - | - | - | - | KADT |
DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" | ||
4256 | A | - | - | - | - | TA |
DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" | ||
4257 | Y | - | - | - | - | Y |
DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" | ||
4258 | K | - | - | - | - | LKCVI |
DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" | ||
4259 | D | - | - | - | - | DKE |
DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" | ||
4260 | Y | - | - | - | - | YAF |
DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" | ||
4261 | L | - | - | - | - | VLI |
DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" | ||
4262 | A | - | - | - | - | KAQND |
DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" | ||
4263 | S | - | - | - | - | SQARNH |
DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" | ||
4264 | G | - | - | - | - | G |
DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" | ||
4265 | G | - | - | - | - | GNAHM |
DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" | ||
4266 | Q | - | - | - | - | QKAVSRT |
DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" | ||
4267 | P | - | - | - | - | P |
DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" | ||
4268 | I | - | - | - | - | VIL |
DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" | ||
4269 | T | - | - | - | - | TGNSAI |
DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" | ||
4270 | N | - | - | - | - | N |
DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" | ||
4271 | C | - | - | - | - | C |
DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" | ||
4272 | V | - | - | - | - | VI |
DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" | ||
4273 | K | - | - | - | - | K |
DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" | ||
4274 | M | - | - | - | - | M |
DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" | ||
4275 | L | - | - | - | - | L |
DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" | ||
4276 | C | - | - | - | - | TCSA |
DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" | ||
4277 | T | - | - | - | - | NDPTV |
DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" | ||
4278 | H | - | - | - | - | HGK |
DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" | ||
4279 | T | - | - | - | - | ATSN |
DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" | ||
4280 | G | - | - | - | - | G |
DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" | ||
4281 | T | - | - | - | - | TNS |
DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" | ||
4282 | G | - | - | - | - | G |
DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" | ||
4283 | Q | - | - | - | - | QMFIL |
DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" | ||
4284 | A | - | - | - | - | A |
DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" | ||
4285 | I | - | - | - | - | IV |
DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" | ||
4286 | T | - | - | - | - | TS |
DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" | ||
4287 | V | - | - | - | - | VNISACT |
DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" | ||
4288 | T | - | - | - | - | KGTS |
DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" | ||
4289 | P | - | - | - | - | PVI |
DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" | ||
4290 | E | - | - | - | - | EDS |
DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" | ||
4291 | A | - | - | - | - | ASP |
DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" | ||
4292 | N | - | - | - | - | NTS |
DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" | ||
4293 | M | - | - | - | - | TMPAI |
DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" | ||
4294 | D | - | - | - | - | DNQT |
DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" | ||
4295 | Q | - | - | - | - | Q |
DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" | ||
4296 | E | - | - | - | - | DE |
DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" | ||
4297 | S | - | - | - | - | ST |
DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" | ||
4298 | F | - | - | - | - | YF |
DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" | ||
4299 | G | - | - | - | - | G |
DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" | ||
4300 | G | - | - | - | - | G |
DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" | ||
4301 | A | - | - | - | - | A |
DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" | ||
4302 | S | - | - | - | - | S |
DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" | ||
4303 | C | - | - | - | - | VCI |
DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" | ||
4304 | C | - | - | - | - | C |
BINDING /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_label="7" ZN_FING DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" BINDING /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_label="7" ZN_FING DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" | ||
4305 | L | - | - | - | - | LI |
ZN_FING DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" ZN_FING DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" | ||
4306 | Y | - | - | - | - | Y |
ZN_FING DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" ZN_FING DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" | ||
4307 | C | - | - | - | - | C |
BINDING /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_label="7" ZN_FING DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" BINDING /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_label="7" ZN_FING DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" | ||
4308 | R | - | - | - | - | R |
ZN_FING DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" ZN_FING DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" | ||
4309 | C | - | - | - | - | ACS |
ZN_FING DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" ZN_FING DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" | ||
4310 | H | - | - | - | - | HR |
ZN_FING DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" ZN_FING DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" | ||
4311 | I | - | - | - | - | VI |
ZN_FING DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" ZN_FING DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" | ||
4312 | D | - | - | - | - | EADP |
ZN_FING DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" ZN_FING DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" | ||
4313 | H | - | - | - | - | H |
BINDING /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_label="7" ZN_FING DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" BINDING /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_label="7" ZN_FING DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" | ||
4314 | P | - | - | - | - | P |
ZN_FING DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" ZN_FING DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" | ||
4315 | N | - | - | - | - | DNSAGT |
ZN_FING DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" ZN_FING DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" | ||
4316 | P | - | - | - | - | VMPLIA |
ZN_FING DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" ZN_FING DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" | ||
4317 | K | - | - | - | - | DKST |
ZN_FING DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" ZN_FING DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" | ||
4318 | G | - | - | - | - | G |
ZN_FING DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" ZN_FING DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" | ||
4319 | F | - | - | - | - | FLVRY |
ZN_FING DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" ZN_FING DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" | ||
4320 | C | - | - | - | - | C |
BINDING /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_label="7" ZN_FING DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" BINDING /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_label="7" ZN_FING DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" | ||
4321 | D | - | - | - | - | KQRD |
DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" | ||
4322 | L | - | - | - | - | LFY |
DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" | ||
4323 | K | - | - | - | - | KR |
DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" | ||
4324 | G | - | - | - | - | G |
DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" | ||
4325 | K | - | - | - | - | KS |
DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" | ||
4326 | Y | - | - | - | - | FYCW |
DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" | ||
4327 | V | - | - | - | - | V |
DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" | ||
4328 | Q | - | - | - | - | Q |
DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" | ||
4329 | I | - | - | - | - | VI |
DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" | ||
4330 | P | - | - | - | - | P |
DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" | ||
4331 | T | - | - | - | - | LTIAV |
DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" | ||
4332 | T | - | - | - | - | GTVHQ |
DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" | ||
4333 | C | - | - | - | - | CTGIALDEKPRSVFNQYHMW |
DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" | ||
4334 | A | - | - | - | - | IVTAEL |
DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" | ||
4335 | N | - | - | - | - | KNQRLADEFGIPSTVY |
DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" | ||
4336 | D | - | - | - | - | D |
DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" | ||
4337 | P | - | - | - | - | P |
DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" | ||
4338 | V | - | - | - | - | VI |
DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" | ||
4339 | G | - | - | - | - | GRSL |
DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" | ||
4340 | F | - | - | - | - | FY |
DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" | ||
4341 | T | - | - | - | - | CVT |
DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" | ||
4342 | L | - | - | - | - | LI |
DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" | ||
4343 | R | - | - | - | - | ERTKQS |
DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" | ||
4344 | N | - | - | - | - | NH |
DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" | ||
4345 | T | - | - | - | - | TDKEVN |
DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" | ||
4346 | V | - | - | - | - | VP |
DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" | ||
4347 | C | - | - | - | - | C |
BINDING /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_label="8" ZN_FING DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" BINDING /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_label="8" ZN_FING DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" | ||
4348 | T | - | - | - | - | TQKNVA |
ZN_FING DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" ZN_FING DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" | ||
4349 | V | - | - | - | - | V |
ZN_FING DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" ZN_FING DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" | ||
4350 | C | - | - | - | - | C |
BINDING /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_label="8" ZN_FING DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" BINDING /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_label="8" ZN_FING DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" | ||
4351 | G | - | - | - | - | GQN |
ZN_FING DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" ZN_FING DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" | ||
4352 | M | - | - | - | - | CFMYT |
ZN_FING DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" ZN_FING DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" | ||
4353 | W | - | - | - | - | W |
ZN_FING DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" ZN_FING DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" | ||
4354 | K | - | - | - | - | LIRKQ |
ZN_FING DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" ZN_FING DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" | ||
4355 | G | - | - | - | - | GDNAST |
ZN_FING DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" ZN_FING DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" | ||
4356 | Y | - | - | - | - | YNGH |
ZN_FING DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" ZN_FING DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" | ||
4357 | G | - | - | - | - | GS |
ZN_FING DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" ZN_FING DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" | ||
4358 | C | - | - | - | - | C |
BINDING /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_label="8" ZN_FING DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" BINDING /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_label="8" ZN_FING DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" | ||
4359 | S | - | - | - | - | STQMNPA |
ZN_FING DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" ZN_FING DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" | ||
4360 | C | - | - | - | - | C |
BINDING /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_label="8" ZN_FING DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" BINDING /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_label="8" ZN_FING DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" | ||
4361 | D | - | - | - | - | DVS |
DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" | ||
4362 | Q | - | - | - | - | RSGQAL |
DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" | ||
4363 | L | - | - | - | - | LTAEGSVDFIKNPQRCHMWY |
DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" | ||
4364 | R | - | - | - | - | RGSTAELVDFHIKMNPQY |
DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" | ||
4365 | E | - | - | - | - | EQGSTDALVFHIKMNPRY |
DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" | ||
4366 | P | - | - | - | - | PTSAQIV |
DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" | ||
4367 | L | - | - | - | - | VATIMFNL |
DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" | ||
4368 | M | - | - | - | - | IQMLVADEGKPRST |
DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" | ||
4369 | Q | - | - | - | - | QSPG |
SITE /note="Cleavage; by 3CL-PRO" DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" SITE /note="Cleavage; by 3CL-PRO" DISORDER predicted by DISOPRED DOMAIN /note="ExoN/MTase coactivator" TOPO_DOM /note="Cytoplasmic" | ||
4370 | S | - | - | - | - | SVQTA |
SITE /note="Cleavage; by 3CL-PRO" TOPO_DOM /note="Cytoplasmic" SITE /note="Cleavage; by 3CL-PRO" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
4371 | A | - | - | - | - | AKTVSRF |
TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
4372 | D | - | - | - | - | DKIGV |
TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
4373 | A | - | - | - | - | ADINLMEGKSTVCFHPQRY |
TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
4374 | S | - | - | - | - | STQEAN |
TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
4375 | T | - | - | - | - | NGTSCDALVEFHIKMPQRY |
TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
4376 | F | - | - | - | - | FY |
TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
4377 | L | - | - | - | - | L |
TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
4378 | N | - | - | - | - | N |
TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
4379 | G | - | - | - | - | GE |
TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
4380 | F | - | - | - | - | FY |
TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
4381 | A | - | - | - | - | GA |
TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
4382 | V | - | - | - | - | V |
TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" |