Contact Molecules for Homologous Proteins | ||||
[Summary Bars] |
[Full Bars] |
|
[Back to Search Page] |
[Back to HOMCOS] |
[Sites by Variants] |
[SupCon3D] |
[help] |
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100] | [show] [download] [help] |
PID | QueryLength | Homolgous Sequence in PDB | UniProt Query | TITLE |
31044 | 122 | 4 | P59635(NS7A_SARS) | RecName: Full=ORF7a protein;AltName: Full=Accessory protein 7a;AltName: Full=Protein U122;AltName: Full=Protein X4;Flags: Precursor; |
QUERYSEQ |
MKIILFLTLIVFTSCELYHYQECVRGTTVLLKEPCPSGTYEGNSPFHPLADNKFALTCTSTHFAFACADGTRHTYQLRARSVSPKLFIRQEEVQQELYSPLFLIVAALVFLILCFTIKRKTE |
[n]:site number of query sequence. [a]:amino acid of query sequence. [s]:predicted secondary structure. [e]:predicted exposed/buried. [acc]:predicted relative accesssibility(%). [pdb]:PDB code of homologous structure. [contact_mols]:predicted binding molecules [observed aa]:Observed amino acids among homologous sequences. [feature table]:UniProt Feature Table [variant]:UniProt Human Variant.
n | a | s | e | acc | pdb | contact_mols | observed aa | feature table | variant |
1 | M | - | - | - | - | M |
SIGNAL DISORDER predicted by DISOPRED SIGNAL | ||
2 | K | - | - | - | - | K |
SIGNAL DISORDER predicted by DISOPRED SIGNAL | ||
3 | I | - | - | - | - | I |
SIGNAL DISORDER predicted by DISOPRED SIGNAL | ||
4 | I | - | - | - | - | I |
SIGNAL DISORDER predicted by DISOPRED SIGNAL | ||
5 | L | - | - | - | - | L |
SIGNAL DISORDER predicted by DISOPRED SIGNAL | ||
6 | F | - | - | - | - | F |
SIGNAL DISORDER predicted by DISOPRED SIGNAL | ||
7 | L | - | - | - | - | L |
SIGNAL DISORDER predicted by DISOPRED SIGNAL | ||
8 | T | - | - | - | - | TA |
SIGNAL DISORDER predicted by DISOPRED SIGNAL | ||
9 | L | - | - | - | - | L |
SIGNAL DISORDER predicted by DISOPRED SIGNAL | ||
10 | I | - | - | - | - | I |
SIGNAL DISORDER predicted by DISOPRED SIGNAL | ||
11 | V | - | - | - | - | TVA |
SIGNAL SIGNAL | ||
12 | F | - | - | - | - | LF |
SIGNAL SIGNAL | ||
13 | T | - | - | - | - | AT |
SIGNAL SIGNAL | ||
14 | S | e | 109.7 | 7ci3_A | ST |
MUTAGEN /note="SCELY->LLLLL: Complete loss of signal sequence cleavage." SIGNAL MUTAGEN /note="SCELY->LLLLL: Complete loss of signal sequence cleavage." SIGNAL | |||
15 | C | e | 50.0 | 7ci3_A | C |
MUTAGEN /note="SCELY->LLLLL: Complete loss of signal sequence cleavage." SIGNAL MUTAGEN /note="SCELY->LLLLL: Complete loss of signal sequence cleavage." SIGNAL | |||
16 | E | B | e | 45.2 | 1yo4_A | E |
MUTAGEN /note="SCELY->LLLLL: Complete loss of signal sequence cleavage." DOMAIN /note="X4e" TOPO_DOM /note="Virion surface" MUTAGEN /note="SCELY->LLLLL: Complete loss of signal sequence cleavage." DOMAIN /note="X4e" TOPO_DOM /note="Virion surface" | ||
17 | L | e | 53.4 | 1yo4_A | L |
MUTAGEN /note="SCELY->LLLLL: Complete loss of signal sequence cleavage." DOMAIN /note="X4e" TOPO_DOM /note="Virion surface" MUTAGEN /note="SCELY->LLLLL: Complete loss of signal sequence cleavage." DOMAIN /note="X4e" TOPO_DOM /note="Virion surface" | |||
18 | Y | e | 53.9 | 1yo4_A | Y |
MUTAGEN /note="SCELY->LLLLL: Complete loss of signal sequence cleavage." DOMAIN /note="X4e" TOPO_DOM /note="Virion surface" MUTAGEN /note="SCELY->LLLLL: Complete loss of signal sequence cleavage." DOMAIN /note="X4e" TOPO_DOM /note="Virion surface" | |||
19 | H | E | e | 40.8 | 1yo4_A | H |
DOMAIN /note="X4e" TOPO_DOM /note="Virion surface" DOMAIN /note="X4e" TOPO_DOM /note="Virion surface" | ||
20 | Y | E | e | 52.6 | 1yo4_A | Y |
DOMAIN /note="X4e" TOPO_DOM /note="Virion surface" DOMAIN /note="X4e" TOPO_DOM /note="Virion surface" | ||
21 | Q | E | e | 37.2 | 1yo4_A | Q |
DOMAIN /note="X4e" TOPO_DOM /note="Virion surface" DOMAIN /note="X4e" TOPO_DOM /note="Virion surface" | ||
22 | E | E | b | 18.6 | 1yo4_A | E |
DOMAIN /note="X4e" TOPO_DOM /note="Virion surface" DOMAIN /note="X4e" TOPO_DOM /note="Virion surface" | ||
23 | C | E | b | 9.3 | 1yo4_A | C |
DISULFID DOMAIN /note="X4e" TOPO_DOM /note="Virion surface" DISULFID DOMAIN /note="X4e" TOPO_DOM /note="Virion surface" | ||
24 | V | E | e | 52.7 | 1yo4_A | V |
DOMAIN /note="X4e" TOPO_DOM /note="Virion surface" DOMAIN /note="X4e" TOPO_DOM /note="Virion surface" | ||
25 | R | T | e | 64.0 | 1yo4_A | R |
DOMAIN /note="X4e" TOPO_DOM /note="Virion surface" DOMAIN /note="X4e" TOPO_DOM /note="Virion surface" | ||
26 | G | T | e | 51.2 | 1yo4_A | G |
DOMAIN /note="X4e" TOPO_DOM /note="Virion surface" DOMAIN /note="X4e" TOPO_DOM /note="Virion surface" | ||
27 | T | S | e | 56.5 | 1yo4_A | T |
DOMAIN /note="X4e" TOPO_DOM /note="Virion surface" DOMAIN /note="X4e" TOPO_DOM /note="Virion surface" | ||
28 | T | E | e | 69.5 | 1yo4_A | T |
DOMAIN /note="X4e" TOPO_DOM /note="Virion surface" DOMAIN /note="X4e" TOPO_DOM /note="Virion surface" | ||
29 | V | E | b | 8.0 | 1yo4_A | V |
DOMAIN /note="X4e" TOPO_DOM /note="Virion surface" DOMAIN /note="X4e" TOPO_DOM /note="Virion surface" | ||
30 | L | E | e | 54.5 | 1yo4_A | L |
DOMAIN /note="X4e" TOPO_DOM /note="Virion surface" DOMAIN /note="X4e" TOPO_DOM /note="Virion surface" | ||
31 | L | E | b | 12.4 | 1yo4_A | L |
DOMAIN /note="X4e" TOPO_DOM /note="Virion surface" DOMAIN /note="X4e" TOPO_DOM /note="Virion surface" | ||
32 | K | E | e | 46.7 | 1yo4_A | K |
DOMAIN /note="X4e" TOPO_DOM /note="Virion surface" DOMAIN /note="X4e" TOPO_DOM /note="Virion surface" | ||
33 | E | b | 16.1 | 1yo4_A | E |
DOMAIN /note="X4e" TOPO_DOM /note="Virion surface" DOMAIN /note="X4e" TOPO_DOM /note="Virion surface" | |||
34 | P | S | e | 34.1 | 1yo4_A | P |
DOMAIN /note="X4e" TOPO_DOM /note="Virion surface" DOMAIN /note="X4e" TOPO_DOM /note="Virion surface" | ||
35 | C | S | b | 11.3 | 1yo4_A | C |
DISULFID DOMAIN /note="X4e" TOPO_DOM /note="Virion surface" DISULFID DOMAIN /note="X4e" TOPO_DOM /note="Virion surface" | ||
36 | P | S | e | 75.2 | 1yo4_A | PS |
DOMAIN /note="X4e" TOPO_DOM /note="Virion surface" DOMAIN /note="X4e" TOPO_DOM /note="Virion surface" | ||
37 | S | S | e | 85.2 | 1yo4_A | S |
DOMAIN /note="X4e" TOPO_DOM /note="Virion surface" DOMAIN /note="X4e" TOPO_DOM /note="Virion surface" | ||
38 | G | e | 28.6 | 1yo4_A | G |
DOMAIN /note="X4e" TOPO_DOM /note="Virion surface" DOMAIN /note="X4e" TOPO_DOM /note="Virion surface" | |||
39 | T | E | e | 74.7 | 1yo4_A | T |
DOMAIN /note="X4e" TOPO_DOM /note="Virion surface" DOMAIN /note="X4e" TOPO_DOM /note="Virion surface" | ||
40 | Y | E | b | 16.1 | 1yo4_A | Y |
DOMAIN /note="X4e" TOPO_DOM /note="Virion surface" DOMAIN /note="X4e" TOPO_DOM /note="Virion surface" | ||
41 | E | E | e | 40.7 | 1yo4_A | E |
DOMAIN /note="X4e" TOPO_DOM /note="Virion surface" DOMAIN /note="X4e" TOPO_DOM /note="Virion surface" | ||
42 | G | S | e | 48.8 | 1yo4_A | G |
DOMAIN /note="X4e" TOPO_DOM /note="Virion surface" DOMAIN /note="X4e" TOPO_DOM /note="Virion surface" | ||
43 | N | S | e | 89.7 | 1yo4_A | N |
DOMAIN /note="X4e" TOPO_DOM /note="Virion surface" DOMAIN /note="X4e" TOPO_DOM /note="Virion surface" | ||
44 | S | S | b | 6.2 | 1yo4_A | S |
DOMAIN /note="X4e" TOPO_DOM /note="Virion surface" DOMAIN /note="X4e" TOPO_DOM /note="Virion surface" | ||
45 | P | e | 48.8 | 1yo4_A | P |
DOMAIN /note="X4e" TOPO_DOM /note="Virion surface" DOMAIN /note="X4e" TOPO_DOM /note="Virion surface" | |||
46 | F | e | 37.3 | 1yo4_A | F |
DOMAIN /note="X4e" TOPO_DOM /note="Virion surface" DOMAIN /note="X4e" TOPO_DOM /note="Virion surface" | |||
47 | H | e | 61.3 | 1yo4_A | H |
DOMAIN /note="X4e" TOPO_DOM /note="Virion surface" DOMAIN /note="X4e" TOPO_DOM /note="Virion surface" | |||
48 | P | E | e | 62.0 | 1yo4_A | P |
DOMAIN /note="X4e" TOPO_DOM /note="Virion surface" DOMAIN /note="X4e" TOPO_DOM /note="Virion surface" | ||
49 | L | E | e | 59.0 | 1yo4_A | L |
DOMAIN /note="X4e" TOPO_DOM /note="Virion surface" DOMAIN /note="X4e" TOPO_DOM /note="Virion surface" | ||
50 | A | T | e | 64.3 | 1yo4_A | A |
DOMAIN /note="X4e" TOPO_DOM /note="Virion surface" DOMAIN /note="X4e" TOPO_DOM /note="Virion surface" | ||
51 | D | T | e | 63.0 | 1yo4_A | D |
DOMAIN /note="X4e" TOPO_DOM /note="Virion surface" DOMAIN /note="X4e" TOPO_DOM /note="Virion surface" | ||
52 | N | T | e | 60.6 | 1yo4_A | N |
DOMAIN /note="X4e" TOPO_DOM /note="Virion surface" DOMAIN /note="X4e" TOPO_DOM /note="Virion surface" | ||
53 | K | E | b | 19.3 | 1yo4_A | K |
DOMAIN /note="X4e" TOPO_DOM /note="Virion surface" DOMAIN /note="X4e" TOPO_DOM /note="Virion surface" | ||
54 | F | E | b | 0.5 | 1yo4_A | F |
DOMAIN /note="X4e" TOPO_DOM /note="Virion surface" DOMAIN /note="X4e" TOPO_DOM /note="Virion surface" | ||
55 | A | E | b | 4.5 | 1yo4_A | A |
DOMAIN /note="X4e" TOPO_DOM /note="Virion surface" DOMAIN /note="X4e" TOPO_DOM /note="Virion surface" | ||
56 | L | E | b | 0.6 | 1yo4_A | L |
DOMAIN /note="X4e" TOPO_DOM /note="Virion surface" DOMAIN /note="X4e" TOPO_DOM /note="Virion surface" | ||
57 | T | E | e | 50.0 | 1yo4_A | T |
DOMAIN /note="X4e" TOPO_DOM /note="Virion surface" DOMAIN /note="X4e" TOPO_DOM /note="Virion surface" | ||
58 | C | b | 0.0 | 1yo4_A | C |
DISULFID DOMAIN /note="X4e" TOPO_DOM /note="Virion surface" DISULFID DOMAIN /note="X4e" TOPO_DOM /note="Virion surface" | |||
59 | T | e | 37.7 | 1yo4_A | TF |
DOMAIN /note="X4e" TOPO_DOM /note="Virion surface" DOMAIN /note="X4e" TOPO_DOM /note="Virion surface" | |||
60 | S | S | e | 51.6 | 1yo4_A | S |
DOMAIN /note="X4e" TOPO_DOM /note="Virion surface" DOMAIN /note="X4e" TOPO_DOM /note="Virion surface" | ||
61 | T | E | b | 11.0 | 1yo4_A | T |
DOMAIN /note="X4e" TOPO_DOM /note="Virion surface" DOMAIN /note="X4e" TOPO_DOM /note="Virion surface" | ||
62 | H | E | e | 58.1 | 1yo4_A | HQ |
DOMAIN /note="X4e" TOPO_DOM /note="Virion surface" DOMAIN /note="X4e" TOPO_DOM /note="Virion surface" | ||
63 | F | E | b | 2.4 | 1yo4_A | F |
DOMAIN /note="X4e" TOPO_DOM /note="Virion surface" DOMAIN /note="X4e" TOPO_DOM /note="Virion surface" | ||
64 | A | E | b | 0.9 | 1yo4_A | A |
DOMAIN /note="X4e" TOPO_DOM /note="Virion surface" DOMAIN /note="X4e" TOPO_DOM /note="Virion surface" | ||
65 | F | E | b | 1.0 | 1yo4_A | F |
DOMAIN /note="X4e" TOPO_DOM /note="Virion surface" DOMAIN /note="X4e" TOPO_DOM /note="Virion surface" | ||
66 | A | E | b | 13.4 | 1yo4_A | A |
DOMAIN /note="X4e" TOPO_DOM /note="Virion surface" DOMAIN /note="X4e" TOPO_DOM /note="Virion surface" | ||
67 | C | b | 6.0 | 1yo4_A | C |
DISULFID DOMAIN /note="X4e" TOPO_DOM /note="Virion surface" DISULFID DOMAIN /note="X4e" TOPO_DOM /note="Virion surface" | |||
68 | A | T | e | 82.1 | 1yo4_A | AP |
DOMAIN /note="X4e" TOPO_DOM /note="Virion surface" DOMAIN /note="X4e" TOPO_DOM /note="Virion surface" | ||
69 | D | T | e | 75.9 | 1yo4_A | D |
DOMAIN /note="X4e" TOPO_DOM /note="Virion surface" DOMAIN /note="X4e" TOPO_DOM /note="Virion surface" | ||
70 | G | S | e | 44.0 | 1yo4_A | G |
DOMAIN /note="X4e" TOPO_DOM /note="Virion surface" DOMAIN /note="X4e" TOPO_DOM /note="Virion surface" | ||
71 | T | b | 19.5 | 1yo4_A | TV |
DOMAIN /note="X4e" TOPO_DOM /note="Virion surface" DOMAIN /note="X4e" TOPO_DOM /note="Virion surface" | |||
72 | R | E | e | 29.2 | 1yo4_A | RK |
DOMAIN /note="X4e" TOPO_DOM /note="Virion surface" DOMAIN /note="X4e" TOPO_DOM /note="Virion surface" | ||
73 | H | E | b | 10.5 | 1yo4_A | H |
DOMAIN /note="X4e" TOPO_DOM /note="Virion surface" DOMAIN /note="X4e" TOPO_DOM /note="Virion surface" | ||
74 | T | E | b | 7.1 | 1yo4_A | TV |
DOMAIN /note="X4e" TOPO_DOM /note="Virion surface" DOMAIN /note="X4e" TOPO_DOM /note="Virion surface" | ||
75 | Y | E | b | 7.0 | 1yo4_A | Y |
DOMAIN /note="X4e" TOPO_DOM /note="Virion surface" DOMAIN /note="X4e" TOPO_DOM /note="Virion surface" | ||
76 | Q | E | e | 40.3 | 1yo4_A | Q |
DOMAIN /note="X4e" TOPO_DOM /note="Virion surface" DOMAIN /note="X4e" TOPO_DOM /note="Virion surface" | ||
77 | L | E | b | 2.8 | 1yo4_A | L |
DOMAIN /note="X4e" TOPO_DOM /note="Virion surface" DOMAIN /note="X4e" TOPO_DOM /note="Virion surface" | ||
78 | R | E | e | 30.4 | 1yo4_A | R |
DOMAIN /note="X4e" TOPO_DOM /note="Virion surface" DOMAIN /note="X4e" TOPO_DOM /note="Virion surface" | ||
79 | A | E | b | 12.5 | 1yo4_A | A |
DOMAIN /note="X4e" TOPO_DOM /note="Virion surface" DOMAIN /note="X4e" TOPO_DOM /note="Virion surface" | ||
80 | R | E | e | 42.7 | 1yo4_A | R |
DOMAIN /note="X4e" TOPO_DOM /note="Virion surface" DOMAIN /note="X4e" TOPO_DOM /note="Virion surface" | ||
81 | S | b | 12.5 | 1yo4_A | S |
DOMAIN /note="X4e" TOPO_DOM /note="Virion surface" DOMAIN /note="X4e" TOPO_DOM /note="Virion surface" | |||
82 | V | S | e | 111.3 | 1yo4_A | V |
TOPO_DOM /note="Virion surface" TOPO_DOM /note="Virion surface" | ||
83 | S | S | e | 35.9 | 1yo4_A | S |
TOPO_DOM /note="Virion surface" TOPO_DOM /note="Virion surface" | ||
84 | P | S | e | 23.3 | 1yo4_A | P |
TOPO_DOM /note="Virion surface" TOPO_DOM /note="Virion surface" | ||
85 | K | e | 69.3 | 1yo4_A | K |
TOPO_DOM /note="Virion surface" TOPO_DOM /note="Virion surface" | |||
86 | L | e | 38.8 | 1yo4_A | L |
TOPO_DOM /note="Virion surface" TOPO_DOM /note="Virion surface" | |||
87 | F | e | 73.7 | 1yo4_A | F |
TOPO_DOM /note="Virion surface" TOPO_DOM /note="Virion surface" | |||
88 | I | e | 66.1 | 1yo4_A | I |
TOPO_DOM /note="Virion surface" TOPO_DOM /note="Virion surface" | |||
89 | R | S | e | 105.1 | 1yo4_A | R |
TOPO_DOM /note="Virion surface" TOPO_DOM /note="Virion surface" | ||
90 | Q | S | e | 60.2 | 1yo4_A | Q |
TOPO_DOM /note="Virion surface" TOPO_DOM /note="Virion surface" | ||
91 | E | S | e | 29.6 | 1yo4_A | E |
TOPO_DOM /note="Virion surface" TOPO_DOM /note="Virion surface" | ||
92 | E | S | b | 12.1 | 1yo4_A | E |
TOPO_DOM /note="Virion surface" TOPO_DOM /note="Virion surface" | ||
93 | V | S | e | 40.7 | 1yo4_A | V |
TOPO_DOM /note="Virion surface" TOPO_DOM /note="Virion surface" | ||
94 | Q | b | 9.2 | 1yo4_A | QHAGLDEIKNPRSTVCFMY |
TOPO_DOM /note="Virion surface" TOPO_DOM /note="Virion surface" | |||
95 | Q | S | e | 81.6 | 1yo4_A | Q |
TOPO_DOM /note="Virion surface" TOPO_DOM /note="Virion surface" | ||
96 | E | S | e | 42.7 | 1yo4_A | E |
TOPO_DOM /note="Virion surface" TOPO_DOM /note="Virion surface" | ||
97 | L | S | e | 61.2 | 1yo4_A | L |
TRANSMEM /note="Helical" TRANSMEM /note="Helical" | ||
98 | Y | e | 47.0 | 1yo4_A | Y |
TRANSMEM /note="Helical" TRANSMEM /note="Helical" | |||
99 | S | e | 43.0 | 1yo4_A | S |
TRANSMEM /note="Helical" TRANSMEM /note="Helical" | |||
100 | P | - | - | - | - | P |
TRANSMEM /note="Helical" TRANSMEM /note="Helical" | ||
101 | L | - | - | - | - | LI |
TRANSMEM /note="Helical" TRANSMEM /note="Helical" | ||
102 | F | - | - | - | - | F |
TRANSMEM /note="Helical" TRANSMEM /note="Helical" | ||
103 | L | - | - | - | - | L |
TRANSMEM /note="Helical" TRANSMEM /note="Helical" | ||
104 | I | - | - | - | - | I |
TRANSMEM /note="Helical" TRANSMEM /note="Helical" | ||
105 | V | - | - | - | - | V |
TRANSMEM /note="Helical" TRANSMEM /note="Helical" | ||
106 | A | - | - | - | - | A |
TRANSMEM /note="Helical" TRANSMEM /note="Helical" | ||
107 | A | - | - | - | - | A |
TRANSMEM /note="Helical" TRANSMEM /note="Helical" | ||
108 | L | - | - | - | - | LI |
TRANSMEM /note="Helical" TRANSMEM /note="Helical" | ||
109 | V | - | - | - | - | V |
TRANSMEM /note="Helical" TRANSMEM /note="Helical" | ||
110 | F | - | - | - | - | F |
TRANSMEM /note="Helical" TRANSMEM /note="Helical" | ||
111 | L | - | - | - | - | IL |
TRANSMEM /note="Helical" TRANSMEM /note="Helical" | ||
112 | I | - | - | - | - | TI |
TRANSMEM /note="Helical" TRANSMEM /note="Helical" | ||
113 | L | - | - | - | - | L |
TRANSMEM /note="Helical" TRANSMEM /note="Helical" | ||
114 | C | - | - | - | - | C |
TRANSMEM /note="Helical" TRANSMEM /note="Helical" | ||
115 | F | - | - | - | - | F |
TRANSMEM /note="Helical" TRANSMEM /note="Helical" | ||
116 | T | - | - | - | - | T |
TRANSMEM /note="Helical" TRANSMEM /note="Helical" | ||
117 | I | - | - | - | - | IL |
TRANSMEM /note="Helical" TRANSMEM /note="Helical" | ||
118 | K | - | - | - | - | K |
MUTAGEN /note="KRK->ERE: Induces rapid exit from the endoplasmic reticulum." TOPO_DOM /note="Intravirion" MOTIF /note="Di-lysine motif" MUTAGEN /note="KRK->ERE: Induces rapid exit from the endoplasmic reticulum." TOPO_DOM /note="Intravirion" MOTIF /note="Di-lysine motif" | ||
119 | R | - | - | - | - | R |
MUTAGEN /note="KRK->ERE: Induces rapid exit from the endoplasmic reticulum." TOPO_DOM /note="Intravirion" MOTIF /note="Di-lysine motif" MUTAGEN /note="KRK->ERE: Induces rapid exit from the endoplasmic reticulum." TOPO_DOM /note="Intravirion" MOTIF /note="Di-lysine motif" | ||
120 | K | - | - | - | - | K |
MUTAGEN /note="KRK->ERE: Induces rapid exit from the endoplasmic reticulum." TOPO_DOM /note="Intravirion" MOTIF /note="Di-lysine motif" MUTAGEN /note="KRK->ERE: Induces rapid exit from the endoplasmic reticulum." TOPO_DOM /note="Intravirion" MOTIF /note="Di-lysine motif" | ||
121 | T | - | - | - | - | T |
TOPO_DOM /note="Intravirion" MOTIF /note="Di-lysine motif" TOPO_DOM /note="Intravirion" MOTIF /note="Di-lysine motif" | ||
122 | E | - | - | - | - | E |
TOPO_DOM /note="Intravirion" MOTIF /note="Di-lysine motif" DISORDER predicted by DISOPRED TOPO_DOM /note="Intravirion" MOTIF /note="Di-lysine motif" |