Contact Molecules for Homologous Proteins | ||||
[Summary Bars] |
[Full Bars] |
|
[Back to Search Page] |
[Back to HOMCOS] |
[SupCon3D] |
[help] |
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100] | [show] [download] [help] |
PID | QueryLength | Homolgous Sequence in PDB | UniProt Query | TITLE |
549886 | 180 | 45 | Q10589(BST2_HUMAN) | RecName: Full=Bone marrow stromal antigen 2; Short=BST-2;AltName: Full=HM1.24 antigen;AltName: Full=Tetherin;AltName: CD_antigen=CD317;Flags: Precursor; |
QUERYSEQ |
MASTSYDYCRVPMEDGDKRCKLLLGIGILVLLIIVILGVPLIIFTIKANSEACRDGLRAVMECRNVTHLLQQELTEAQKGFQDVEAQAATCNHTVMALMASLDAEKAQGQKKVEELEGEITTLNHKLQDASAEVERLRRENQVLSVRIAD KKYYPSSQDSSSAAAPQLLIVLLGLSALLQ |
All | LB/B (likely benign or benign) | ||
Number of sites | 180 | 1 | |
Buired or Exposed | Buried | 0.0 (%) [0] | 0.0 (%) [0] |
Exposed | 100.0 (%) [111] | 100.0 (%) [1] | |
Ave relacc | 56.9 % | 39.3 % | |
SD relacc | 13.92 % | 0.00 % | |
Contact Mol | hetero | 0.0 (%) [0] | 0.0 (%) [0] |
nucleotide | 0.0 (%) [0] | 0.0 (%) [0] | |
compound | 2.8 (%) [5] | 0.0 (%) [0] | |
metal | 8.3 (%) [15] | 0.0 (%) [0] | |
otherpoly | 0.0 (%) [0] | 0.0 (%) [0] | |
homo | 58.9 (%) [106] | 100.0 (%) [1] | |
precipitant | 0.6 (%) [1] | 0.0 (%) [0] | |
Number of variants | 1 | 1 | |
N_Freq(AAvariant)==0 % | 100.0 % [1] | ||
N_Freq(AAvariant)>0 % | 0.0 % [0] | ||
Ave Freq(AAvariant) | 0.0 % | ||
SD Freq(AAvariant) | 0.00 % |
1 sites | 143 |
[n]:site number of query sequence. [a]:amino acid of query sequence. [s]:predicted secondary structure. [e]:predicted exposed/buried. [acc]:predicted relative accesssibility(%). [pdb]:PDB code of homologous structure. [contact_mols]:predicted binding molecules [observed aa]:Observed amino acids among homologous sequences. [feature table]:UniProt Feature Table [variant]:UniProt Human Variant.
n | a | s | e | acc | pdb | contact_mols | observed aa | feature table | variant |
143 | V | H | e | 39.3 | 3mqb_A | homo | EV |
COILED TOPO_DOM /note="Extracellular" COILED TOPO_DOM /note="Extracellular" | V->F:(0.0 %):LB/B - dbSNP:rs1804402 |