Contact Molecules for Homologous Proteins | ||||
[Summary Bars] |
[Full Bars] |
|
[Back to Search Page] |
[Back to HOMCOS] |
[Sites by Variants] |
[SupCon3D] |
[help] |
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100] | [show] [download] [help] |
PID | QueryLength | Homolgous Sequence in PDB | UniProt Query | TITLE |
31605 | 154 | 0 | P59633(NS3B_SARS) | RecName: Full=ORF3b protein;AltName: Full=Accessory protein 3b;AltName: Full=Non-structural protein 3b; Short=ns3b;AltName: Full=Protein X2; |
QUERYSEQ |
MMPTTLFAGTHITMTTVYHITVSQIQLSLLKVTAFQHQNSKKTTKLVVILRIGTQVLKTMSLYMAISPKFTTSLSLHKLLQTLVLKMLHSSSLTSLLKTHRMCKYTQSTALQELLIQQWIQFMMSRRRLLACLCKHKKVSTNLCTHSFRK KQVR |
[n]:site number of query sequence. [a]:amino acid of query sequence. [s]:predicted secondary structure. [e]:predicted exposed/buried. [acc]:predicted relative accesssibility(%). [pdb]:PDB code of homologous structure. [contact_mols]:predicted binding molecules [observed aa]:Observed amino acids among homologous sequences. [feature table]:UniProt Feature Table [variant]:UniProt Human Variant.
n | a | s | e | acc | pdb | contact_mols | observed aa | feature table | variant |
1 | M | - | - | - | - | DISORDER predicted by DISOPRED | |||
2 | M | - | - | - | - | DISORDER predicted by DISOPRED | |||
3 | P | - | - | - | - | ||||
4 | T | - | - | - | - | ||||
5 | T | - | - | - | - | ||||
6 | L | - | - | - | - | ||||
7 | F | - | - | - | - | ||||
8 | A | - | - | - | - | ||||
9 | G | - | - | - | - | ||||
10 | T | - | - | - | - | ||||
11 | H | - | - | - | - | ||||
12 | I | - | - | - | - | ||||
13 | T | - | - | - | - | ||||
14 | M | - | - | - | - | ||||
15 | T | - | - | - | - | ||||
16 | T | - | - | - | - | ||||
17 | V | - | - | - | - | ||||
18 | Y | - | - | - | - | ||||
19 | H | - | - | - | - | ||||
20 | I | - | - | - | - | ||||
21 | T | - | - | - | - | ||||
22 | V | - | - | - | - | ||||
23 | S | - | - | - | - | ||||
24 | Q | - | - | - | - | ||||
25 | I | - | - | - | - | ||||
26 | Q | - | - | - | - | ||||
27 | L | - | - | - | - | ||||
28 | S | - | - | - | - | ||||
29 | L | - | - | - | - | ||||
30 | L | - | - | - | - | ||||
31 | K | - | - | - | - | ||||
32 | V | - | - | - | - | ||||
33 | T | - | - | - | - | ||||
34 | A | - | - | - | - | ||||
35 | F | - | - | - | - | ||||
36 | Q | - | - | - | - | ||||
37 | H | - | - | - | - | ||||
38 | Q | - | - | - | - | ||||
39 | N | - | - | - | - | ||||
40 | S | - | - | - | - | ||||
41 | K | - | - | - | - | ||||
42 | K | - | - | - | - | ||||
43 | T | - | - | - | - | ||||
44 | T | - | - | - | - | ||||
45 | K | - | - | - | - | ||||
46 | L | - | - | - | - | ||||
47 | V | - | - | - | - | ||||
48 | V | - | - | - | - | ||||
49 | I | - | - | - | - | ||||
50 | L | - | - | - | - | ||||
51 | R | - | - | - | - | ||||
52 | I | - | - | - | - | ||||
53 | G | - | - | - | - | ||||
54 | T | - | - | - | - | ||||
55 | Q | - | - | - | - | ||||
56 | V | - | - | - | - | ||||
57 | L | - | - | - | - | ||||
58 | K | - | - | - | - | ||||
59 | T | - | - | - | - | ||||
60 | M | - | - | - | - | ||||
61 | S | - | - | - | - | ||||
62 | L | - | - | - | - | ||||
63 | Y | - | - | - | - | ||||
64 | M | - | - | - | - | ||||
65 | A | - | - | - | - | ||||
66 | I | - | - | - | - | ||||
67 | S | - | - | - | - | ||||
68 | P | - | - | - | - | ||||
69 | K | - | - | - | - | ||||
70 | F | - | - | - | - | ||||
71 | T | - | - | - | - | ||||
72 | T | - | - | - | - | ||||
73 | S | - | - | - | - | ||||
74 | L | - | - | - | - | ||||
75 | S | - | - | - | - | ||||
76 | L | - | - | - | - | ||||
77 | H | - | - | - | - | ||||
78 | K | - | - | - | - | ||||
79 | L | - | - | - | - | ||||
80 | L | - | - | - | - | REGION /note="Mitochondrial targeting signal" REGION /note="Mitochondrial targeting signal" | |||
81 | Q | - | - | - | - | REGION /note="Mitochondrial targeting signal" REGION /note="Mitochondrial targeting signal" | |||
82 | T | - | - | - | - | REGION /note="Mitochondrial targeting signal" REGION /note="Mitochondrial targeting signal" | |||
83 | L | - | - | - | - | REGION /note="Mitochondrial targeting signal" REGION /note="Mitochondrial targeting signal" | |||
84 | V | - | - | - | - | REGION /note="Mitochondrial targeting signal" REGION /note="Mitochondrial targeting signal" | |||
85 | L | - | - | - | - | REGION /note="Mitochondrial targeting signal" REGION /note="Mitochondrial targeting signal" | |||
86 | K | - | - | - | - | REGION /note="Mitochondrial targeting signal" REGION /note="Mitochondrial targeting signal" | |||
87 | M | - | - | - | - | REGION /note="Mitochondrial targeting signal" REGION /note="Mitochondrial targeting signal" | |||
88 | L | - | - | - | - | REGION /note="Mitochondrial targeting signal" REGION /note="Mitochondrial targeting signal" | |||
89 | H | - | - | - | - | REGION /note="Mitochondrial targeting signal" REGION /note="Mitochondrial targeting signal" | |||
90 | S | - | - | - | - | REGION /note="Mitochondrial targeting signal" REGION /note="Mitochondrial targeting signal" | |||
91 | S | - | - | - | - | REGION /note="Mitochondrial targeting signal" REGION /note="Mitochondrial targeting signal" | |||
92 | S | - | - | - | - | REGION /note="Mitochondrial targeting signal" REGION /note="Mitochondrial targeting signal" | |||
93 | L | - | - | - | - | REGION /note="Mitochondrial targeting signal" REGION /note="Mitochondrial targeting signal" | |||
94 | T | - | - | - | - | REGION /note="Mitochondrial targeting signal" REGION /note="Mitochondrial targeting signal" | |||
95 | S | - | - | - | - | REGION /note="Mitochondrial targeting signal" REGION /note="Mitochondrial targeting signal" | |||
96 | L | - | - | - | - | REGION /note="Mitochondrial targeting signal" REGION /note="Mitochondrial targeting signal" | |||
97 | L | - | - | - | - | REGION /note="Mitochondrial targeting signal" REGION /note="Mitochondrial targeting signal" | |||
98 | K | - | - | - | - | REGION /note="Mitochondrial targeting signal" REGION /note="Mitochondrial targeting signal" | |||
99 | T | - | - | - | - | REGION /note="Mitochondrial targeting signal" REGION /note="Mitochondrial targeting signal" | |||
100 | H | - | - | - | - | REGION /note="Mitochondrial targeting signal" REGION /note="Mitochondrial targeting signal" | |||
101 | R | - | - | - | - | REGION /note="Mitochondrial targeting signal" REGION /note="Mitochondrial targeting signal" | |||
102 | M | - | - | - | - | REGION /note="Mitochondrial targeting signal" REGION /note="Mitochondrial targeting signal" | |||
103 | C | - | - | - | - | REGION /note="Mitochondrial targeting signal" REGION /note="Mitochondrial targeting signal" | |||
104 | K | - | - | - | - | REGION /note="Mitochondrial targeting signal" REGION /note="Mitochondrial targeting signal" | |||
105 | Y | - | - | - | - | REGION /note="Mitochondrial targeting signal" REGION /note="Mitochondrial targeting signal" | |||
106 | T | - | - | - | - | REGION /note="Mitochondrial targeting signal" REGION /note="Mitochondrial targeting signal" | |||
107 | Q | - | - | - | - | REGION /note="Mitochondrial targeting signal" REGION /note="Mitochondrial targeting signal" | |||
108 | S | - | - | - | - | REGION /note="Mitochondrial targeting signal" REGION /note="Mitochondrial targeting signal" | |||
109 | T | - | - | - | - | REGION /note="Mitochondrial targeting signal" REGION /note="Mitochondrial targeting signal" | |||
110 | A | - | - | - | - | REGION /note="Mitochondrial targeting signal" REGION /note="Mitochondrial targeting signal" | |||
111 | L | - | - | - | - | REGION /note="Mitochondrial targeting signal" REGION /note="Mitochondrial targeting signal" | |||
112 | Q | - | - | - | - | REGION /note="Mitochondrial targeting signal" REGION /note="Mitochondrial targeting signal" | |||
113 | E | - | - | - | - | REGION /note="Mitochondrial targeting signal" REGION /note="Mitochondrial targeting signal" | |||
114 | L | - | - | - | - | REGION /note="Mitochondrial targeting signal" REGION /note="Mitochondrial targeting signal" | |||
115 | L | - | - | - | - | REGION /note="Mitochondrial targeting signal" REGION /note="Mitochondrial targeting signal" | |||
116 | I | - | - | - | - | REGION /note="Mitochondrial targeting signal" REGION /note="Mitochondrial targeting signal" | |||
117 | Q | - | - | - | - | REGION /note="Mitochondrial targeting signal" REGION /note="Mitochondrial targeting signal" | |||
118 | Q | - | - | - | - | REGION /note="Mitochondrial targeting signal" REGION /note="Mitochondrial targeting signal" | |||
119 | W | - | - | - | - | REGION /note="Mitochondrial targeting signal" REGION /note="Mitochondrial targeting signal" | |||
120 | I | - | - | - | - | REGION /note="Mitochondrial targeting signal" REGION /note="Mitochondrial targeting signal" | |||
121 | Q | - | - | - | - | REGION /note="Mitochondrial targeting signal" REGION /note="Mitochondrial targeting signal" | |||
122 | F | - | - | - | - | REGION /note="Mitochondrial targeting signal" REGION /note="Mitochondrial targeting signal" | |||
123 | M | - | - | - | - | REGION /note="Mitochondrial targeting signal" REGION /note="Mitochondrial targeting signal" | |||
124 | M | - | - | - | - | REGION /note="Mitochondrial targeting signal" REGION /note="Mitochondrial targeting signal" | |||
125 | S | - | - | - | - | REGION /note="Mitochondrial targeting signal" REGION /note="Mitochondrial targeting signal" | |||
126 | R | - | - | - | - | REGION /note="Mitochondrial targeting signal" REGION /note="Mitochondrial targeting signal" | |||
127 | R | - | - | - | - | REGION /note="Mitochondrial targeting signal" REGION /note="Mitochondrial targeting signal" | |||
128 | R | - | - | - | - | REGION /note="Mitochondrial targeting signal" REGION /note="Mitochondrial targeting signal" | |||
129 | L | - | - | - | - | REGION /note="Mitochondrial targeting signal" REGION /note="Mitochondrial targeting signal" | |||
130 | L | - | - | - | - | REGION /note="Mitochondrial targeting signal" REGION /note="Mitochondrial targeting signal" | |||
131 | A | - | - | - | - | REGION /note="Mitochondrial targeting signal" REGION /note="Mitochondrial targeting signal" | |||
132 | C | - | - | - | - | REGION /note="Mitochondrial targeting signal" REGION /note="Mitochondrial targeting signal" | |||
133 | L | - | - | - | - | REGION /note="Mitochondrial targeting signal" REGION /note="Mitochondrial targeting signal" | |||
134 | C | - | - | - | - | REGION /note="Nucleolar targeting" REGION /note="Mitochondrial targeting signal" REGION /note="Nucleolar targeting" REGION /note="Mitochondrial targeting signal" | |||
135 | K | - | - | - | - | MOTIF /note="Bipartite nuclear localization signal" REGION /note="Nucleolar targeting" REGION /note="Mitochondrial targeting signal" MOTIF /note="Bipartite nuclear localization signal" REGION /note="Nucleolar targeting" REGION /note="Mitochondrial targeting signal" | |||
136 | H | - | - | - | - | MOTIF /note="Bipartite nuclear localization signal" REGION /note="Nucleolar targeting" REGION /note="Mitochondrial targeting signal" MOTIF /note="Bipartite nuclear localization signal" REGION /note="Nucleolar targeting" REGION /note="Mitochondrial targeting signal" | |||
137 | K | - | - | - | - | MOTIF /note="Bipartite nuclear localization signal" REGION /note="Nucleolar targeting" REGION /note="Mitochondrial targeting signal" MOTIF /note="Bipartite nuclear localization signal" REGION /note="Nucleolar targeting" REGION /note="Mitochondrial targeting signal" | |||
138 | K | - | - | - | - | MOTIF /note="Bipartite nuclear localization signal" REGION /note="Nucleolar targeting" REGION /note="Mitochondrial targeting signal" MOTIF /note="Bipartite nuclear localization signal" REGION /note="Nucleolar targeting" REGION /note="Mitochondrial targeting signal" | |||
139 | V | - | - | - | - | MOTIF /note="Bipartite nuclear localization signal" REGION /note="Nucleolar targeting" MOTIF /note="Bipartite nuclear localization signal" REGION /note="Nucleolar targeting" | |||
140 | S | - | - | - | - | MOTIF /note="Bipartite nuclear localization signal" REGION /note="Nucleolar targeting" MOTIF /note="Bipartite nuclear localization signal" REGION /note="Nucleolar targeting" | |||
141 | T | - | - | - | - | MOTIF /note="Bipartite nuclear localization signal" REGION /note="Nucleolar targeting" MOTIF /note="Bipartite nuclear localization signal" REGION /note="Nucleolar targeting" | |||
142 | N | - | - | - | - | MOTIF /note="Bipartite nuclear localization signal" REGION /note="Nucleolar targeting" MOTIF /note="Bipartite nuclear localization signal" REGION /note="Nucleolar targeting" | |||
143 | L | - | - | - | - | MOTIF /note="Bipartite nuclear localization signal" REGION /note="Nucleolar targeting" MOTIF /note="Bipartite nuclear localization signal" REGION /note="Nucleolar targeting" | |||
144 | C | - | - | - | - | MOTIF /note="Bipartite nuclear localization signal" REGION /note="Nucleolar targeting" MOTIF /note="Bipartite nuclear localization signal" REGION /note="Nucleolar targeting" | |||
145 | T | - | - | - | - | MOTIF /note="Bipartite nuclear localization signal" REGION /note="Nucleolar targeting" MOTIF /note="Bipartite nuclear localization signal" REGION /note="Nucleolar targeting" | |||
146 | H | - | - | - | - | MOTIF /note="Bipartite nuclear localization signal" REGION /note="Nucleolar targeting" MOTIF /note="Bipartite nuclear localization signal" REGION /note="Nucleolar targeting" | |||
147 | S | - | - | - | - | MOTIF /note="Bipartite nuclear localization signal" REGION /note="Nucleolar targeting" MOTIF /note="Bipartite nuclear localization signal" REGION /note="Nucleolar targeting" | |||
148 | F | - | - | - | - | MOTIF /note="Bipartite nuclear localization signal" REGION /note="Nucleolar targeting" MOTIF /note="Bipartite nuclear localization signal" REGION /note="Nucleolar targeting" | |||
149 | R | - | - | - | - | MOTIF /note="Bipartite nuclear localization signal" REGION /note="Nucleolar targeting" MOTIF /note="Bipartite nuclear localization signal" REGION /note="Nucleolar targeting" | |||
150 | K | - | - | - | - | MOTIF /note="Bipartite nuclear localization signal" REGION /note="Nucleolar targeting" MOTIF /note="Bipartite nuclear localization signal" REGION /note="Nucleolar targeting" | |||
151 | K | - | - | - | - | MOTIF /note="Bipartite nuclear localization signal" REGION /note="Nucleolar targeting" MOTIF /note="Bipartite nuclear localization signal" REGION /note="Nucleolar targeting" | |||
152 | Q | - | - | - | - | MOTIF /note="Bipartite nuclear localization signal" REGION /note="Nucleolar targeting" MOTIF /note="Bipartite nuclear localization signal" REGION /note="Nucleolar targeting" | |||
153 | V | - | - | - | - | MOTIF /note="Bipartite nuclear localization signal" REGION /note="Nucleolar targeting" DISORDER predicted by DISOPRED MOTIF /note="Bipartite nuclear localization signal" REGION /note="Nucleolar targeting" | |||
154 | R | - | - | - | - | REGION /note="Nucleolar targeting" DISORDER predicted by DISOPRED REGION /note="Nucleolar targeting" |