[All Sites]

Contact Molecules for Homologous Proteins


[Summary Bars]

[Full Bars]


Sites by Variants[40 %]


[Back to Search Page]

[Back to HOMCOS]

[SupCon3D]

[help]
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
29626 180 47 Q10589(BST2_HUMAN) RecName: Full=Bone marrow stromal antigen 2; Short=BST-2;AltName: Full=HM1.24 antigen;AltName: Full=Tetherin;AltName: CD_antigen=CD317;Flags: Precursor;
QUERYSEQ
MASTSYDYCRVPMEDGDKRCKLLLGIGILVLLIIVILGVPLIIFTIKANSEACRDGLRAVMECRNVTHLLQQELTEAQKGFQDVEAQAATCNHTVMALMASLDAEKAQGQKKVEELEGEITTLNHKLQDASAEVERLRRENQVLSVRIAD
KKYYPSSQDSSSAAAPQLLIVLLGLSALLQ
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

Statistics of sites in view of Disease classification

All LB/B (likely benign or benign)
Number of sites 180 1
Buired or ExposedBuried 0.0 (%) [0] 0.0 (%) [0]
Exposed 100.0 (%) [111] 100.0 (%) [1]
Ave relacc 56.9 % 39.3 %
SD relacc 13.92 % 0.00 %
Contact Molhetero 0.0 (%) [0] 0.0 (%) [0]
nucleotide 0.0 (%) [0] 0.0 (%) [0]
compound 2.8 (%) [5] 0.0 (%) [0]
metal 8.3 (%) [15] 0.0 (%) [0]
otherpoly 0.0 (%) [0] 0.0 (%) [0]
homo 60.0 (%) [108] 100.0 (%) [1]
precipitant 2.8 (%) [5] 0.0 (%) [0]
Number of variants 1 1
N_Freq(AAvariant)==0 % 100.0 % [1]
N_Freq(AAvariant)>0 % 0.0 % [0]
Ave Freq(AAvariant) 0.0 %
SD Freq(AAvariant) 0.00 %

Site Table for OMIM:LB/B [1 variants]

1 sites 143
  [n]:site number of query sequence.  [a]:amino acid of query sequence.  [s]:predicted secondary structure.
  [e]:predicted exposed/buried.  [acc]:predicted relative accesssibility(%).  [pdb]:PDB code of homologous structure.
  [contact_mols]:predicted binding molecules  [observed aa]:Observed amino acids among homologous sequences.  [feature table]:UniProt Feature Table
  [variant]:UniProt Human Variant.
n a s e acc pdb contact_mols observed aa feature table variant
143VHe 39.3 3mqb_A homo
EV
COILED TOPO_DOM /note="Extracellular" COILED TOPO_DOM /note="Extracellular" V->F:(0.0 %):LB/B - dbSNP:rs1804402