Contact Molecules for Homologous Proteins | ||||
![]() [Summary Bars] |
![]() [Full Bars] |
|
![]() [Back to Search Page] |
![]() [Back to HOMCOS] |
![]() [SupCon3D] |
![]() [help] |
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100] | ![]() [show] [download] [help] |
PID | QueryLength | Homolgous Sequence in PDB | UniProt Query | TITLE |
2715 | 75 | 30 | P0DTC4(VEMP_SARS2) | RecName: Full=Envelope small membrane protein ; Short=E; Short=sM protein ; |
QUERYSEQ |
MYSFVSEETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCCNIVNVSLVKPSFYVYSRVKNLNSSRVPDLLV |
All | ||
Number of sites | 75 | |
Buired or Exposed | Buried | 3.0 (%) [2] |
Exposed | 97.0 (%) [65] | |
Ave relacc | 66.5 % | |
SD relacc | 24.47 % | |
Contact Mol | hetero | 13.3 (%) [10] |
nucleotide | 0.0 (%) [0] | |
compound | 0.0 (%) [0] | |
metal | 0.0 (%) [0] | |
otherpoly | 0.0 (%) [0] | |
homo | 46.7 (%) [35] | |
precipitant | 1.3 (%) [1] | |
Number of variants | 0 | |
N_Freq(AAvariant)==0 % | ||
N_Freq(AAvariant)>0 % | ||
Ave Freq(AAvariant) | ||
SD Freq(AAvariant) |