Contact Molecules for Homologous Proteins | ||||
[Summary Bars] |
[Full Bars] |
|
[Back to Search Page] |
[Back to HOMCOS] |
[Sites by Variants] |
[SupCon3D] |
[help] |
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100] | [show] [download] [help] |
PID | QueryLength | Homolgous Sequence in PDB | UniProt Query | TITLE |
21876 | 675 | 24 | Q8N3R9(PALS1_HUMAN) | RecName: Full=Protein PALS1 ;AltName: Full=MAGUK p55 subfamily member 5;AltName: Full=Membrane protein, palmitoylated 5 ;AltName: Full=Protein associated with Lin-7 1 ; |
QUERYSEQ |
MTTSHMNGHVTEESDSEVKNVDLASPEEHQKHREMAVDCPGDLGTRMMPIRRSAQLERIRQQQEDMRRRREEEGKKQELDLNSSMRLKKLAQIPPKTGIDNPMFDTEEGIVLESPHYAVKILEIEDLFSSLKHIQHTLVDSQSQEDISLL LQLVQNKDFQNAFKIHNAITVHMNKASPPFPLISNAQDLAQEVQTVLKPVHHKEGQELTALLNTPHIQALLLAHDKVAEQEMQLEPITDERVYESIGQYGGETVKIVRIEKARDIPLGATVRNEMDSVIISRIVKGGAAEKSGLLHEGDE VLEINGIEIRGKDVNEVFDLLSDMHGTLTFVLIPSQQIKPPPAKETVIHVKAHFDYDPSDDPYVPCRELGLSFQKGDILHVISQEDPNWWQAYREGDEDNQPLAGLVPGKSFQQQREAMKQTIEEDKEPEKSGKLWCAKKNKKKRKKVLY NANKNDDYDNEEILTYEEMSLYHQPANRKRPIILIGPQNCGQNELRQRLMNKEKDRFASAVPHTTRSRRDQEVAGRDYHFVSRQAFEADIAAGKFIEHGEFEKNLYGTSIDSVRQVINSGKICLLSLRTQSLKTLRNSDLKPYIIFIAPP SQERLRALLAKEGKNPKPEELREIIEKTREMEQNNGHYFDTAIVNSDLDKAYQELLRLINKLDTEPQWVPSTWLR |
[n]:site number of query sequence. [a]:amino acid of query sequence. [s]:predicted secondary structure. [e]:predicted exposed/buried. [acc]:predicted relative accesssibility(%). [pdb]:PDB code of homologous structure. [contact_mols]:predicted binding molecules [observed aa]:Observed amino acids among homologous sequences. [feature table]:UniProt Feature Table [variant]:UniProt Human Variant.
n | a | s | e | acc | pdb | contact_mols | observed aa | feature table | variant |
1 | M | - | - | - | - | M |
REGION /note="Disordered" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED REGION /note="Disordered" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
2 | T | - | - | - | - | T |
REGION /note="Disordered" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED REGION /note="Disordered" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
3 | T | - | - | - | - | T |
REGION /note="Disordered" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED REGION /note="Disordered" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
4 | S | - | - | - | - | S |
REGION /note="Disordered" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED REGION /note="Disordered" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
5 | H | - | - | - | - | H |
REGION /note="Disordered" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED REGION /note="Disordered" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
6 | M | - | - | - | - | M |
REGION /note="Disordered" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED REGION /note="Disordered" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
7 | N | - | - | - | - | N |
REGION /note="Disordered" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED REGION /note="Disordered" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
8 | G | - | - | - | - | G |
REGION /note="Disordered" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED REGION /note="Disordered" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
9 | H | - | - | - | - | HY |
REGION /note="Disordered" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED REGION /note="Disordered" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
10 | V | - | - | - | - | V |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" COMPBIAS /note="Basic and acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
11 | T | - | - | - | - | T |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" COMPBIAS /note="Basic and acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
12 | E | - | - | - | - | E |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" COMPBIAS /note="Basic and acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
13 | E | - | - | - | - | ES |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" COMPBIAS /note="Basic and acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
14 | S | - | - | - | - | SD |
MOD_RES /note="Phosphoserine" COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" MOD_RES /note="Phosphoserine" COMPBIAS /note="Basic and acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
15 | D | - | - | - | - | DG |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" COMPBIAS /note="Basic and acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
16 | S | - | - | - | - | SG |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" COMPBIAS /note="Basic and acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
17 | E | - | - | - | - | EAGLSDIKNPQRTVCFHMY |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" COMPBIAS /note="Basic and acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
18 | V | - | - | - | - | VAGLSDEIKNPQRTCFHMY |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" COMPBIAS /note="Basic and acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
19 | K | - | - | - | - | KG |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" COMPBIAS /note="Basic and acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
20 | N | - | - | - | - | NG |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" COMPBIAS /note="Basic and acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
21 | V | - | - | - | - | VT |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" COMPBIAS /note="Basic and acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
22 | D | - | - | - | - | D |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" COMPBIAS /note="Basic and acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
23 | L | - | - | - | - | LI |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" COMPBIAS /note="Basic and acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
24 | A | - | - | - | - | AV |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" COMPBIAS /note="Basic and acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
25 | S | - | - | - | - | SE |
MOD_RES /note="Phosphoserine" ECO:0007744|PubMed:23186163" COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" MOD_RES /note="Phosphoserine" ECO:0007744|PubMed:23186163" COMPBIAS /note="Basic and acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
26 | P | - | - | - | - | PAGLSDEIKNQRTVCFHMY |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" COMPBIAS /note="Basic and acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
27 | E | - | - | - | - | E |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" COMPBIAS /note="Basic and acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
28 | E | - | - | - | - | EG |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" COMPBIAS /note="Basic and acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
29 | H | - | - | - | - | HV |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" COMPBIAS /note="Basic and acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
30 | Q | - | - | - | - | Q |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
31 | K | - | - | - | - | KR |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
32 | H | - | - | - | - | H |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
33 | R | - | - | - | - | R |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
34 | E | - | - | - | - | E |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
35 | M | - | - | - | - | M |
REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
36 | A | - | - | - | - | A |
REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
37 | V | - | - | - | - | V |
REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
38 | D | - | - | - | - | D |
REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
39 | C | - | - | - | - | C |
REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
40 | P | - | - | - | - | P |
REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
41 | G | - | - | - | - | GS |
REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
42 | D | - | - | - | - | DE |
REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
43 | L | - | - | - | - | L |
REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
44 | G | - | - | - | - | G |
REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
45 | T | - | - | - | - | TA |
REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
46 | R | - | - | - | - | R |
REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
47 | M | - | - | - | - | MT |
REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
48 | M | - | - | - | - | ML |
REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
49 | P | - | - | - | - | P |
REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
50 | I | - | - | - | - | IV |
REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
51 | R | - | - | - | - | R |
REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
52 | R | - | - | - | - | RD |
REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
53 | S | - | - | - | - | SR |
REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
54 | A | - | - | - | - | AD |
REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
55 | Q | - | - | - | - | QK |
REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
56 | L | - | - | - | - | L |
REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
57 | E | - | - | - | - | EQ |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
58 | R | - | - | - | - | RK |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
59 | I | - | - | - | - | IL |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
60 | R | - | - | - | - | RA |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
61 | Q | - | - | - | - | QD |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
62 | Q | - | - | - | - | QT |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
63 | Q | - | - | - | - | QV |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
64 | E | - | - | - | - | E |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
65 | D | - | - | - | - | DE |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
66 | M | - | - | - | - | MLR |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
67 | R | - | - | - | - | RK |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
68 | R | - | - | - | - | R |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
69 | R | - | - | - | - | R |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
70 | R | - | - | - | - | RE |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
71 | E | - | - | - | - | EK |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
72 | E | - | - | - | - | EL |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
73 | E | - | - | - | - | EKG |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
74 | G | - | - | - | - | GR |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
75 | K | - | - | - | - | KAS |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
76 | K | - | - | - | - | KVR |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
77 | Q | - | - | - | - | Q |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
78 | E | - | - | - | - | EA |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
79 | L | - | - | - | - | LI |
REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
80 | D | - | - | - | - | DA |
REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
81 | L | - | - | - | - | LG |
REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
82 | N | - | - | - | - | NG |
REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
83 | S | - | - | - | - | ST |
MOD_RES /note="Phosphoserine" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" MOD_RES /note="Phosphoserine" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
84 | S | - | - | - | - | SN |
MOD_RES /note="Phosphoserine" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" MOD_RES /note="Phosphoserine" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
85 | M | - | - | - | - | M |
REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
86 | R | - | - | - | - | RD |
REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
87 | L | - | - | - | - | L |
REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
88 | K | - | - | - | - | KY |
REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
89 | K | - | - | - | - | KA |
REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
90 | L | - | - | - | - | LT |
REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
91 | A | - | - | - | - | ADS |
REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
92 | Q | - | - | - | - | QA |
REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
93 | I | - | - | - | - | IDAGLSEFHKMNPQRTVY |
REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
94 | P | - | - | - | - | PMN |
REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
95 | P | - | - | - | - | P |
REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
96 | K | - | - | - | - | KI |
REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
97 | T | - | - | - | - | TV |
REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
98 | G | - | - | - | - | G |
REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
99 | I | - | - | - | - | IA |
REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
100 | D | - | - | - | - | DT |
REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
101 | N | - | - | - | - | ND |
REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
102 | P | - | - | - | - | PE |
REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
103 | M | - | - | - | - | MWT |
REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
104 | F | - | - | - | - | FA |
REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
105 | D | - | - | - | - | DE |
REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
106 | T | - | - | - | - | TEQ |
REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
107 | E | - | - | - | - | EM |
REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
108 | E | - | - | - | - | EA |
REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
109 | G | - | - | - | - | G |
REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
110 | I | - | - | - | - | IP |
REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
111 | V | - | - | - | - | VEG |
REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
112 | L | - | - | - | - | LAGSDEIKNPQRTVCFHMWY |
REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
113 | E | - | - | - | - | EQAGLSDIKNPRTVCFHMWY |
REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
114 | S | - | - | - | - | SAGLDEIKNPQRTVCFHMWY |
REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
115 | P | - | - | - | - | PLAGSDEIKNQRTVCFHMWY |
REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
116 | H | - | - | - | - | HIAGLSDEKNPQRTVCFMWY |
REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
117 | Y | - | - | - | - | YAGLSDEIKNPQRTVCFHMW |
REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
118 | A | - | - | - | - | APGLSDEIKNQRTVCFHMWY |
REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
119 | V | S | e | 70.7 | 3uit_D | precipitant | VPAGLSDEIKNQRTCFHMWY |
REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
120 | K | e | 47.6 | 3uit_D | AK |
DOMAIN /note="L27 1" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="L27 1" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |||
121 | I | e | 21.6 | 3uit_D | IVL |
DOMAIN /note="L27 1" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="L27 1" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |||
122 | L | b | 0.0 | 3uit_D | LQ |
DOMAIN /note="L27 1" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="L27 1" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |||
123 | E | e | 46.7 | 3uit_D | ER |
DOMAIN /note="L27 1" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="L27 1" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |||
124 | I | H | b | 10.5 | 3uit_D | IVL |
DOMAIN /note="L27 1" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="L27 1" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
125 | E | H | e | 46.7 | 3uit_D | ESL |
DOMAIN /note="L27 1" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="L27 1" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
126 | D | H | e | 33.3 | 3uit_D | hetero INADL_HUMAN | DQ |
DOMAIN /note="L27 1" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="L27 1" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
127 | L | H | b | 0.0 | 3uit_D | hetero INADL_HUMAN | LVC |
DOMAIN /note="L27 1" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="L27 1" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
128 | F | H | e | 33.5 | 3uit_D | LF |
DOMAIN /note="L27 1" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="L27 1" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
129 | S | H | e | 39.1 | 3uit_D | DSM |
DOMAIN /note="L27 1" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="L27 1" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
130 | S | H | b | 0.0 | 3uit_D | hetero INADL_HUMAN | SD |
DOMAIN /note="L27 1" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="L27 1" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
131 | L | H | b | 2.8 | 3uit_D | LI |
DOMAIN /note="L27 1" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="L27 1" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
132 | K | H | e | 69.3 | 3uit_D | KEY |
DOMAIN /note="L27 1" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="L27 1" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
133 | H | H | e | 33.5 | 3uit_D | hetero INADL_HUMAN | HESQ |
DOMAIN /note="L27 1" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="L27 1" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
134 | I | H | b | 0.0 | 3uit_D | hetero INADL_HUMAN | ILV |
DOMAIN /note="L27 1" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="L27 1" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
135 | Q | H | e | 45.4 | 3uit_D | QAEGLSVDFHIKMNPRTY |
DOMAIN /note="L27 1" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="L27 1" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
136 | H | H | e | 83.8 | 3uit_D | HD |
DOMAIN /note="L27 1" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="L27 1" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
137 | T | H | b | 15.6 | 3uit_D | hetero INADL_HUMAN | ATS |
DOMAIN /note="L27 1" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED DOMAIN /note="L27 1" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
138 | L | b | 0.6 | 3uit_D | hetero INADL_HUMAN | LH |
DOMAIN /note="L27 1" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="L27 1" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
139 | V | e | 75.3 | 3uit_D | VTNI |
DOMAIN /note="L27 1" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="L27 1" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |||
140 | D | S | e | 30.2 | 3uit_D | hetero INADL_HUMAN | D |
DOMAIN /note="L27 1" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED DOMAIN /note="L27 1" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
141 | S | H | e | 67.2 | 3uit_D | SCA |
DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
142 | Q | H | e | 42.3 | 3uit_D | hetero INADL_HUMAN | QNDEAFGIKLPRSTVY |
DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
143 | S | H | b | 0.0 | 3uit_D | hetero INADL_HUMAN | SHV |
DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
144 | Q | H | e | 35.2 | 3uit_D | QELRKP |
DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
145 | E | H | e | 54.8 | 3uit_D | EKRD |
DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
146 | D | H | b | 4.9 | 3uit_D | hetero INADL_HUMAN | DE |
DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
147 | I | H | b | 0.6 | 3uit_D | hetero INADL_HUMAN | LVMIRADEGKNPQST |
DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
148 | S | H | e | 51.6 | 3uit_D | TSCGDEAIKLNPQRV |
DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
149 | L | H | e | 32.0 | 3uit_D | FLADEGIKNPQRSTV |
DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
150 | L | H | b | 0.0 | 3uit_D | hetero INADL_HUMAN | LMV |
DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
151 | L | H | e | 27.5 | 3uit_D | LWHRY |
DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
152 | Q | H | e | 73.5 | 3uit_D | DQRSA |
DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
153 | L | H | e | 25.8 | 3uit_D | hetero INADL_HUMAN | LVMD |
DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
154 | V | H | b | 0.0 | 3uit_D | FVLN |
DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
155 | Q | H | e | 54.6 | 3uit_D | QGHSR |
DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
156 | N | e | 41.8 | 3uit_D | ESNLDK |
DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |||
157 | K | H | e | 67.5 | 3uit_D | KPHQR |
DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
158 | D | H | e | 25.3 | 3uit_D | hetero INADL_HUMAN | SWDQHG |
DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
159 | F | H | b | 1.0 | 3uit_D | hetero INADL_HUMAN | LF |
DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
160 | Q | H | e | 24.0 | 3uit_D | HQLSG |
DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
161 | N | H | e | 50.3 | 3uit_D | hetero INADL_HUMAN | SAYNQTK |
DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
162 | A | H | b | 0.0 | 3uit_D | hetero INADL_HUMAN | LA |
DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
163 | F | H | b | 0.0 | 3uit_D | hetero INADL_HUMAN | FLVM |
DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
164 | K | H | e | 56.1 | 3uit_D | KDS |
DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
165 | I | H | b | 9.4 | 3uit_D | hetero INADL_HUMAN precipitant | IRLV |
DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
166 | H | H | b | 0.0 | 3uit_D | hetero INADL_HUMAN | HYI |
DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
167 | N | H | b | 10.9 | 3uit_D | EDNA |
DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
168 | A | H | e | 32.1 | 3uit_D | precipitant | KACS |
DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
169 | I | H | b | 1.2 | 3uit_D | hetero INADL_HUMAN | LITV |
DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
170 | T | H | b | 1.3 | 3uit_D | hetero INADL_HUMAN | QRTVNAGLDEFIKPSY |
DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
171 | V | H | e | 25.3 | 3uit_D | VYTEHRCAGLDFIKNPQS |
DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
172 | H | H | e | 72.8 | 3uit_D | HYFTK |
DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
173 | M | H | e | 45.9 | 3uit_D | SMEYKC |
DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
174 | N | S | e | 22.4 | 3uit_D | NYERSD |
DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
175 | K | e | 62.3 | 3uit_D | precipitant | KEQGPRC |
DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
176 | A | e | 74.1 | 3uit_D | KASRQP |
DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |||
177 | S | S | e | 64.8 | 3uit_D | SLQANEDFGIKPRTVY |
DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
178 | P | e | 89.1 | 3uit_D | PNSAGLDEIKQRTVCFHMY |
REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |||
179 | P | e | 32.6 | 3uit_D | precipitant | PADEFGIKLNQRSTV |
DOMAIN /note="L27 2" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED DOMAIN /note="L27 2" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
180 | F | e | 71.3 | 3uit_D | precipitant | VTFASYLM |
DOMAIN /note="L27 2" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED DOMAIN /note="L27 2" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
181 | P | e | 21.7 | 3uit_D | PED |
DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |||
182 | L | S | e | 51.7 | 3uit_D | AVLID |
DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
183 | I | e | 27.5 | 3uit_D | LTVI |
DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |||
184 | S | S | e | 71.1 | 3uit_D | HQDSGPT |
DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
185 | N | e | 37.6 | 3uit_D | HSRGN |
DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |||
186 | A | H | b | 0.0 | 3uit_D | AC |
DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
187 | Q | H | e | 33.7 | 3uit_D | QARKMGVT |
DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
188 | D | H | e | 61.7 | 3uit_D | ADEITVS |
DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
189 | L | H | b | 4.5 | 3uit_D | LV |
DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
190 | A | H | b | 3.6 | 3uit_D | ALST |
DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
191 | Q | H | e | 47.4 | 3uit_D | EQDCYA |
DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
192 | E | H | e | 37.2 | 3uit_D | EDQ |
DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
193 | V | H | b | 0.0 | 3uit_D | VLI |
DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
194 | Q | H | b | 5.1 | 3uit_D | QSAMELVT |
DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
195 | T | H | e | 42.9 | 3uit_D | ETCSVDN |
DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
196 | V | H | e | 23.3 | 3uit_D | ETLVIYMK |
DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
197 | L | H | b | 1.7 | 3uit_D | LPV |
DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
198 | K | T | e | 71.7 | 3uit_D | KQREGP |
DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
199 | P | T | e | 82.9 | 3uit_D | APDGENSIKLRTV |
DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
200 | V | b | 13.3 | 3uit_D | SLAKVTPDEGINR |
DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |||
201 | H | e | 86.4 | 3uit_D | precipitant | SAEHNYGTDIKLPRV |
DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
202 | H | S | e | 46.6 | 3uit_D | HSNGADEIKLPRTV |
DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
203 | K | S | e | 71.7 | 3uit_D | precipitant | SKPNEV |
DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
204 | E | H | b | 12.1 | 3uit_D | EDGA |
DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
205 | G | H | b | 2.4 | 3uit_D | IGEALSV |
DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
206 | Q | H | e | 53.1 | 3uit_D | precipitant | QRGKLASV |
DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
207 | E | H | e | 29.1 | 3uit_D | precipitant | EG |
DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
208 | L | H | b | 0.0 | 3uit_D | LM |
DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
209 | T | H | e | 24.0 | 3uit_D | LRATVKMS |
DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
210 | A | H | e | 41.1 | 3uit_D | QKRATGSH |
DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
211 | L | H | b | 9.0 | 3uit_D | LIAMV |
DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
212 | L | H | b | 1.1 | 3uit_D | L |
DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
213 | N | H | e | 52.7 | 3uit_D | SQNAKT |
DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
214 | T | S | e | 20.1 | 3uit_D | TKAEDQ |
DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
215 | P | H | e | 48.1 | 3uit_D | PLS |
DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
216 | H | H | b | 12.0 | 3uit_D | precipitant | HNY |
DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
217 | I | H | b | 1.2 | 3uit_D | FLVMIC |
DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
218 | Q | H | e | 36.2 | 3uit_D | QKREM |
DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
219 | A | H | b | 7.1 | 3uit_D | ASH |
DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
220 | L | H | b | 0.6 | 3uit_D | LV |
DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
221 | L | H | b | 1.1 | 3uit_D | LM |
DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
222 | L | H | e | 29.8 | 3uit_D | SEMQLH |
DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
223 | A | H | b | 0.0 | 3uit_D | AVTKS |
DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
224 | H | H | b | 1.0 | 3uit_D | H |
DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
225 | D | H | b | 9.3 | 3uit_D | DN |
DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
226 | K | H | e | 29.2 | 3uit_D | TSVKRI |
DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
227 | V | H | e | 25.3 | 3uit_D | VPI |
DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
228 | A | H | b | 11.6 | 3uit_D | AE |
DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
229 | E | S | e | 52.3 | 3uit_D | QESPDK |
DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
230 | Q | S | e | 66.8 | 3uit_D | KQEV |
DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
231 | E | S | e | 89.9 | 3uit_D | SNEADTC |
DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
232 | M | S | e | 58.0 | 3uit_D | YFMLP |
DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
233 | Q | - | - | - | - | DEQR |
DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
234 | L | - | - | - | - | LVTS |
DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
235 | E | - | - | - | - | PETLS |
DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
236 | P | S | e | 94.6 | 1va8_A | PA |
REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
237 | I | e | 64.3 | 1va8_A | LPVMIS |
REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |||
238 | T | S | e | 90.3 | 1va8_A | PSLMTNV |
REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
239 | D | e | 72.2 | 1va8_A | DPEGY |
REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |||
240 | E | e | 64.3 | 1va8_A | DEGLSNA |
REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |||
241 | R | e | 77.1 | 1va8_A | NAIMLRSDEGKPTV |
REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |||
242 | V | e | 110.0 | 1va8_A | IDVGYNPAL |
REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |||
243 | Y | S | e | 71.7 | 1va8_A | YDPTEISNAL |
REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
244 | E | e | 66.8 | 4wsi_A | ETDNSPAGLVFHIKMQRY |
REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |||
245 | S | E | e | 71.9 | 4wsi_A | SEFGLANTDIKPQRVY |
REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
246 | I | E | e | 44.4 | 4wsi_A | ILSPDNFAEGKTVQRCHMWY |
REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
247 | G | e | 64.3 | 4wsi_A | NGDATLEKSVFIPQRCHMWY |
REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |||
248 | Q | e | 54.1 | 4wsi_A | QEAVDGLSIKNPRTCFHMY |
REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |||
249 | Y | S | e | 110.0 | 4wsi_A | ILVYEFMWAGSDKNPQRTCH |
REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
250 | G | S | e | 91.7 | 4wsi_A | GPAEMDLSVFIKNQRTCHWY |
REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
251 | G | S | e | 66.7 | 4wsi_A | metal CL | GEPAVMDFIKLNQRST |
REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
252 | E | e | 61.8 | 4wsi_A | metal CL | EDKPR |
REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
253 | T | e | 58.4 | 4wsi_A | SATNDPKL |
REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |||
254 | V | E | b | 6.0 | 4wsi_A | VHMTRIL |
REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
255 | K | E | e | 20.3 | 4wsi_A | metal CL | RK |
REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
256 | I | E | b | 7.0 | 4wsi_A | LIVRM |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
257 | V | E | b | 6.7 | 4wsi_A | VIL |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
258 | R | E | e | 49.8 | 4wsi_A | RQFGLKCAS |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
259 | I | E | b | 2.9 | 4wsi_A | IFLHSV |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
260 | E | E | e | 58.8 | 4wsi_A | KVERHQYCLP |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
261 | K | E | b | 7.1 | 4wsi_A | hetero CRUM1_HUMAN CRB_DROME VEMP_SARS2 precipitant | KGR |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
262 | A | B | e | 48.2 | 4wsi_A | metal CL homo | GSNAVTDK |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
263 | R | T | e | 64.0 | 4wsi_A | compound PUN metal CL homo | TQKRLDASY |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
264 | D | T | e | 75.3 | 4wsi_A | metal NA | EDGSQTAKLV |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
265 | I | B | e | 54.4 | 4wsi_A | homo | LEIVKRFADGNPQST |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
266 | P | e | 63.6 | 4wsi_A | hetero VEMP_SARS2 CRB_DROME VEMP_SARS CRUM1_HUMAN homo precipitant | PGATDEHS |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
267 | L | b | 8.4 | 4wsi_A | hetero VEMP_SARS2 CRB_DROME VEMP_SARS CRUM1_HUMAN | LIMF |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
268 | G | S | b | 6.0 | 4wsi_A | hetero VEMP_SARS2 CRB_DROME VEMP_SARS CRUM1_HUMAN homo | GREN |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
269 | A | E | e | 30.4 | 4wsi_A | hetero VEMP_SARS2 CRB_DROME VEMP_SARS CRUM1_HUMAN | AIVLGFS |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
270 | T | E | b | 11.0 | 4wsi_A | hetero VEMP_SARS2 CRB_DROME VEMP_SARS CRUM1_HUMAN | TALYSGV |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
271 | V | E | e | 29.3 | 4wsi_A | hetero VEMP_SARS2 CRB_DROME VEMP_SARS CRUM1_HUMAN | IGLVCFAP |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
272 | R | E | e | 31.6 | 4wsi_A | hetero VEMP_SARS2 CRB_DROME VEMP_SARS CRUM1_HUMAN | GRKSDYAEILPTV |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
273 | N | E | e | 29.1 | 4wsi_A | hetero CRB_DROME VEMP_SARS2 | NGDEKRSVHMAILPT |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
274 | E | E | e | 20.6 | 4wsi_A | hetero CRB_DROME VEMP_SARS2 | DETNKPQAGILRSV |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
275 | M | T | e | 50.7 | 4wsi_A | VGLFMIKTEDNAPRS |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
276 | D | T | e | 42.0 | 4wsi_A | GDHEQPTSNALVFIKMRY |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
277 | S | E | b | 3.1 | 4wsi_A | GPSAEKRDHL |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
278 | V | E | b | 0.0 | 4wsi_A | IVCL |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
279 | I | E | b | 8.2 | 4wsi_A | FYVILTMS |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
280 | I | E | b | 2.3 | 4wsi_A | VI |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
281 | S | E | e | 22.7 | 4wsi_A | hetero VEMP_SARS2 CRB_DROME VEMP_SARS | ASKG |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
282 | R | E | b | 10.7 | 4wsi_A | hetero CRB_DROME CRUM1_HUMAN VEMP_SARS2 precipitant | RGFEKNAS |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
283 | I | E | b | 14.0 | 4wsi_A | IVLM |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
284 | V | b | 1.3 | 4wsi_A | hetero VEMP_SARS2 VEMP_SARS homo | LVMQEITYAF |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
285 | K | T | e | 23.1 | 4wsi_A | homo precipitant | PEHADKR |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
286 | G | T | e | 23.8 | 4wsi_A | GDR |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
287 | G | S | b | 6.0 | 4wsi_A | homo | GST |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
288 | A | H | e | 37.5 | 4wsi_A | PLAMSVI |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
289 | A | H | b | 0.0 | 4wsi_A | AIV |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
290 | E | H | e | 28.6 | 4wsi_A | EDHKAIQ |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
291 | K | H | e | 72.2 | 4wsi_A | homo | RQGLSK |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
292 | S | H | e | 35.2 | 4wsi_A | STQEPHDCAGN |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
293 | G | T | e | 47.6 | 4wsi_A | GDAS |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
294 | L | e | 32.0 | 4wsi_A | LGEAKTISRN |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |||
295 | L | b | 2.2 | 4wsi_A | LIVADEFGKNPQRST |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |||
296 | H | e | 46.6 | 4wsi_A | precipitant | HKQVARMEYG |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
297 | E | T | e | 28.6 | 4wsi_A | homo | VEPRAKIT |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
298 | G | T | b | 17.9 | 4wsi_A | homo | GNS |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
299 | D | b | 0.0 | 4wsi_A | DM |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |||
300 | E | E | b | 13.6 | 4wsi_A | EQRLIKV |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
301 | V | E | b | 2.0 | 4wsi_A | ILV |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
302 | L | E | b | 11.2 | 4wsi_A | LRIVKMA |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
303 | E | E | e | 35.2 | 4wsi_A | ESAKQR |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
304 | I | E | b | 1.2 | 4wsi_A | VIYW |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
305 | N | T | e | 43.0 | 4wsi_A | NG |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
306 | G | T | e | 81.0 | 4wsi_A | GSNTD |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
307 | I | E | e | 29.8 | 4wsi_A | VIQLCMTHKS |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
308 | E | E | e | 55.3 | 4wsi_A | precipitant | DSPENAVT |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
309 | I | b | 0.0 | 4wsi_A | VLFMI |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |||
310 | R | T | e | 36.0 | 4wsi_A | precipitant | RTAEKLQSD |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
311 | G | T | e | 63.1 | 4wsi_A | GNSHDEA |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
312 | K | e | 29.2 | 4wsi_A | KALRQVHIESN |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |||
313 | D | e | 38.9 | 4wsi_A | TSRDPIHKNQ |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |||
314 | V | H | e | 20.7 | 4wsi_A | hetero VEMP_SARS2 VEMP_SARS CRUM1_HUMAN CRB_DROME | HVPLREYQ |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
315 | N | H | e | 62.4 | 4wsi_A | hetero VEMP_SARS2 CRB_DROME VEMP_SARS CRUM1_HUMAN | EDSKNRG |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
316 | E | H | e | 47.2 | 4wsi_A | EQADKHS |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
317 | V | H | b | 6.0 | 4wsi_A | hetero CRB_DROME VEMP_SARS2 | VALI |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
318 | F | H | e | 56.9 | 4wsi_A | hetero VEMP_SARS2 CRB_DROME VEMP_SARS CRUM1_HUMAN metal CL precipitant | VQIATYLFS |
MUTAGEN /note="F->A,C: Increases interaction with CRB1." DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" MUTAGEN /note="F->A,C: Increases interaction with CRB1." DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
319 | D | H | e | 58.6 | 4wsi_A | EQDHSAKVYLNRI |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
320 | L | H | e | 26.4 | 4wsi_A | LIMAFE |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
321 | L | H | b | 17.4 | 4wsi_A | hetero VEMP_SARS2 VEMP_SARS CRUM1_HUMAN CRB_DROME precipitant | LMI |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
322 | S | H | e | 34.4 | 4wsi_A | metal NA precipitant | KALRSQTEIV |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
323 | D | T | e | 81.5 | 4wsi_A | metal NA | AQENDKMGIPVRST |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
324 | M | b | 11.6 | 4wsi_A | ASPNLMTQRI |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |||
325 | H | e | 47.1 | 4wsi_A | compound PUN | GSKQPRDHCEAN |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
326 | G | E | e | 27.4 | 4wsi_A | GQEHPDNKR |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
327 | T | E | e | 42.2 | 4wsi_A | TSGNVAEMKQY |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
328 | L | E | b | 0.0 | 4wsi_A | VLIEMT |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
329 | T | E | e | 24.7 | 4wsi_A | TISEKVRMD |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
330 | F | E | b | 2.9 | 4wsi_A | LFVITM |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
331 | V | E | b | 16.7 | 4wsi_A | KVTILQARE |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
332 | L | E | b | 0.0 | 4wsi_A | IVLYATG |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
333 | I | E | b | 18.1 | 4wsi_A | ILRAVKQFPMDEGST |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
334 | P | e | 39.5 | 4wsi_A | PQRYASTNDEFGIKLV |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |||
335 | S | e | 24.2 | 4wsi_A | SAGQRKVENIDLPT |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |||
336 | Q | e | 37.8 | 4wsi_A | SQEGYITADHRKNP |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |||
337 | Q | e | 41.8 | 4wsi_A | QEKRSDFLP |
REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |||
338 | I | e | 44.4 | 4wsi_A | VILSTYDEKGPANFQR |
REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |||
339 | K | e | 33.5 | 4wsi_A | KERDAQISTFGP |
REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |||
340 | P | e | 82.2 | 4wsi_A | PLERAHGKSDWIQ |
REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |||
341 | P | S | e | 90.7 | 4wsi_A | PKADELGQSRTVYI |
REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
342 | P | e | 103.9 | 4wsi_A | PTAVCRGLMEKQ |
REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |||
343 | A | e | 79.5 | 4wsi_A | SRLGNACTYFQVI |
REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |||
344 | K | e | 42.9 | 4wsi_A | KRQSEADPFHLN |
REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |||
345 | E | e | 70.9 | 4wsi_A | ESGKQRANDVWILPT |
DOMAIN /note="SH3" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED DOMAIN /note="SH3" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |||
346 | T | e | 62.3 | 4wsi_A | RGSDTAEIQKPLFNVY |
DOMAIN /note="SH3" DISORDER predicted by DISOPRED DOMAIN /note="SH3" | |||
347 | V | e | 36.7 | 4wsi_A | SKVMDQPTLAEFGINRY |
DOMAIN /note="SH3" DISORDER predicted by DISOPRED DOMAIN /note="SH3" | |||
348 | I | E | e | 39.8 | 4wsi_A | homo | FVILMS |
DOMAIN /note="SH3" DISORDER predicted by DISOPRED DOMAIN /note="SH3" | |
349 | H | E | e | 66.5 | 4wsi_A | homo | YFSHR |
DOMAIN /note="SH3" DISORDER predicted by DISOPRED DOMAIN /note="SH3" | |
350 | V | E | e | 32.0 | 4wsi_A | homo | VIME |
DOMAIN /note="SH3" DISORDER predicted by DISOPRED DOMAIN /note="SH3" | |
351 | K | E | e | 58.0 | 4wsi_A | homo | RKTQ |
DOMAIN /note="SH3" DISORDER predicted by DISOPRED DOMAIN /note="SH3" | |
352 | A | b | 4.5 | 4wsi_A | homo | ASTCG |
DOMAIN /note="SH3" DISORDER predicted by DISOPRED DOMAIN /note="SH3" | ||
353 | H | e | 73.3 | 4wsi_A | homo | LHDQM |
DOMAIN /note="SH3" DISORDER predicted by DISOPRED DOMAIN /note="SH3" | ||
354 | F | S | e | 32.5 | 4wsi_A | homo | FAYIT |
DOMAIN /note="SH3" DISORDER predicted by DISOPRED DOMAIN /note="SH3" | |
355 | D | e | 61.7 | 4wsi_A | DEH |
DOMAIN /note="SH3" DISORDER predicted by DISOPRED DOMAIN /note="SH3" | |||
356 | Y | B | b | 11.3 | 4wsi_A | YERFLC |
DOMAIN /note="SH3" DISORDER predicted by DISOPRED DOMAIN /note="SH3" | ||
357 | D | e | 44.4 | 4wsi_A | DENWLQY |
DOMAIN /note="SH3" DISORDER predicted by DISOPRED DOMAIN /note="SH3" | |||
358 | P | G | b | 11.6 | 4wsi_A | PAKRDEGILNQSTV |
DOMAIN /note="SH3" DISORDER predicted by DISOPRED DOMAIN /note="SH3" | ||
359 | S | G | e | 51.6 | 4wsi_A | ASKQTRENFL |
DOMAIN /note="SH3" DISORDER predicted by DISOPRED DOMAIN /note="SH3" | ||
360 | D | G | e | 58.6 | 4wsi_A | EDKRPVMANQGILST |
DOMAIN /note="SH3" DISORDER predicted by DISOPRED DOMAIN /note="SH3" | ||
361 | D | b | 8.0 | 4wsi_A | DPTESNAGIKLQRV |
DOMAIN /note="SH3" DISORDER predicted by DISOPRED DOMAIN /note="SH3" | |||
362 | P | S | e | 30.2 | 4wsi_A | PSGDKNREAFILQTV |
DOMAIN /note="SH3" DISORDER predicted by DISOPRED DOMAIN /note="SH3" | ||
363 | Y | e | 38.7 | 4wsi_A | LGAYDEQVCSFIKNPRT |
DOMAIN /note="SH3" DISORDER predicted by DISOPRED DOMAIN /note="SH3" | |||
364 | V | b | 5.3 | 4wsi_A | ILAVFDEGKNPRSTCHMQY |
DOMAIN /note="SH3" DISORDER predicted by DISOPRED DOMAIN /note="SH3" | |||
365 | P | S | e | 51.2 | 4wsi_A | hetero CRB_DROME VEMP_SARS2 | PALDEGIKRSTVCFHMNQY |
DOMAIN /note="SH3" DISORDER predicted by DISOPRED DOMAIN /note="SH3" | |
366 | C | b | 10.7 | 4wsi_A | hetero CRB_DROME | CSDHLAEGKPTVFIMNQRY |
DOMAIN /note="SH3" DISORDER predicted by DISOPRED DOMAIN /note="SH3" | ||
367 | R | G | e | 40.7 | 4wsi_A | KQRMVAGPLDEISTCFHNY |
DOMAIN /note="SH3" DISORDER predicted by DISOPRED DOMAIN /note="SH3" | ||
368 | E | G | e | 68.3 | 4wsi_A | hetero CRB_DROME | EDQSFAGLIKNPRTVCHMY |
DOMAIN /note="SH3" DOMAIN /note="SH3" | |
369 | L | G | b | 14.6 | 4wsi_A | hetero CRB_DROME VEMP_SARS2 | ALPQMGSDEIKNRTVCFHY |
DOMAIN /note="SH3" DOMAIN /note="SH3" | |
370 | G | B | e | 27.4 | 4wsi_A | GAES |
DOMAIN /note="SH3" DOMAIN /note="SH3" | ||
371 | L | b | 7.9 | 4wsi_A | LIVAEGKST |
DOMAIN /note="SH3" DOMAIN /note="SH3" | |||
372 | S | e | 41.4 | 4wsi_A | SPGKAQRNCELTV |
DOMAIN /note="SH3" DOMAIN /note="SH3" | |||
373 | F | B | b | 3.3 | 4wsi_A | F |
DOMAIN /note="SH3" DOMAIN /note="SH3" | ||
374 | Q | e | 68.4 | 4wsi_A | KQRNTSLA |
DOMAIN /note="SH3" DOMAIN /note="SH3" | |||
375 | K | T | e | 67.5 | 4wsi_A | KRFYTVAHQ |
DOMAIN /note="SH3" DOMAIN /note="SH3" | ||
376 | G | T | e | 36.9 | 4wsi_A | GDR |
DOMAIN /note="SH3" DOMAIN /note="SH3" | ||
377 | D | e | 29.6 | 4wsi_A | DEQ |
DOMAIN /note="SH3" DOMAIN /note="SH3" | |||
378 | I | E | e | 35.1 | 4wsi_A | IVFL |
DOMAIN /note="SH3" DOMAIN /note="SH3" | ||
379 | L | E | b | 3.9 | 4wsi_A | LIF |
DOMAIN /note="SH3" DOMAIN /note="SH3" | ||
380 | H | E | b | 16.8 | 4wsi_A | HQRYAE |
DOMAIN /note="SH3" DOMAIN /note="SH3" | ||
381 | V | E | b | 2.0 | 4wsi_A | VI |
DOMAIN /note="SH3" DOMAIN /note="SH3" | ||
382 | I | E | b | 14.0 | 4wsi_A | IVLMFT |
DOMAIN /note="SH3" DOMAIN /note="SH3" | ||
383 | S | E | b | 8.6 | 4wsi_A | DNSPE |
DOMAIN /note="SH3" DOMAIN /note="SH3" | ||
384 | Q | e | 42.3 | 4wsi_A | QAKNSTDCR |
DOMAIN /note="SH3" DOMAIN /note="SH3" | |||
385 | E | S | e | 57.8 | 4wsi_A | SDGLEVNQ |
DOMAIN /note="SH3" DOMAIN /note="SH3" | ||
386 | D | S | e | 28.4 | 4wsi_A | DKYTVCH |
MUTAGEN /note="D->K: Reduces binding to Drosophila crb and causes incorrect PALS1 localization and cell polarity." DOMAIN /note="SH3" MUTAGEN /note="D->K: Reduces binding to Drosophila crb and causes incorrect PALS1 localization and cell polarity." DOMAIN /note="SH3" | ||
387 | P | T | e | 43.4 | 4wsi_A | PDAFLEHKSV |
DOMAIN /note="SH3" DOMAIN /note="SH3" | ||
388 | N | T | e | 23.0 | 4wsi_A | GNETLDH |
DOMAIN /note="SH3" DOMAIN /note="SH3" | ||
389 | W | E | b | 7.2 | 4wsi_A | WSHL |
DOMAIN /note="SH3" DOMAIN /note="SH3" | ||
390 | W | E | b | 15.5 | 4wsi_A | homo | W |
DOMAIN /note="SH3" DOMAIN /note="SH3" | |
391 | Q | E | b | 3.6 | 4wsi_A | QLKMT |
DOMAIN /note="SH3" DOMAIN /note="SH3" | ||
392 | A | E | b | 0.0 | 4wsi_A | AG |
DOMAIN /note="SH3" DOMAIN /note="SH3" | ||
393 | Y | E | b | 18.7 | 4wsi_A | RKVWAISGYH |
DOMAIN /note="SH3" DOMAIN /note="SH3" | ||
394 | R | E | e | 20.2 | 4wsi_A | RKLVHCQSADEGT |
DOMAIN /note="SH3" DOMAIN /note="SH3" | ||
395 | E | T | e | 62.8 | 4wsi_A | VEIQMHRDL |
DOMAIN /note="SH3" DOMAIN /note="SH3" | ||
396 | G | T | e | 71.4 | 4wsi_A | GTLHANSM |
DOMAIN /note="SH3" DOMAIN /note="SH3" | ||
397 | D | e | 22.8 | 4wsi_A | DNPSRGKQEALIV |
DOMAIN /note="SH3" DOMAIN /note="SH3" | |||
398 | E | e | 96.0 | 4wsi_A | EDNSTAHGLPKQ |
DOMAIN /note="SH3" DOMAIN /note="SH3" | |||
399 | D | S | e | 59.9 | 4wsi_A | GNLDAHSTEKIPQRV |
DOMAIN /note="SH3" DOMAIN /note="SH3" | ||
400 | N | e | 55.2 | 4wsi_A | EANLRDIKMSTGFPQV |
DOMAIN /note="SH3" DOMAIN /note="SH3" | |||
401 | Q | e | 47.4 | 4wsi_A | EQSRFKLTAVGNDHIMPY |
DOMAIN /note="SH3" DOMAIN /note="SH3" | |||
402 | P | e | 58.9 | 4wsi_A | EPKQVDTIAGLNRSCFHMY |
DOMAIN /note="SH3" DOMAIN /note="SH3" | |||
403 | L | S | e | 21.3 | 4wsi_A | hetero CRB_DROME | EIRCLADQSVFGKTHMNPY |
DOMAIN /note="SH3" DOMAIN /note="SH3" | |
404 | A | b | 4.5 | 4wsi_A | ARQTIMNEVGL |
DOMAIN /note="SH3" DOMAIN /note="SH3" | |||
405 | G | E | b | 10.7 | 4wsi_A | GY |
DOMAIN /note="SH3" DOMAIN /note="SH3" | ||
406 | L | E | b | 0.6 | 4wsi_A | LVIQYF |
DOMAIN /note="SH3" DOMAIN /note="SH3" | ||
407 | V | E | b | 1.3 | 4wsi_A | homo | IVFT |
DOMAIN /note="SH3" DOMAIN /note="SH3" | |
408 | P | E | b | 17.1 | 4wsi_A | homo | P |
DOMAIN /note="SH3" DOMAIN /note="SH3" | |
409 | G | b | 10.7 | 4wsi_A | SNLG |
DOMAIN /note="SH3" DOMAIN /note="SH3" | |||
410 | K | e | 47.6 | 4wsi_A | homo | KQNP |
DOMAIN /note="SH3" DOMAIN /note="SH3" | ||
411 | S | - | - | - | - | SRYEHKNQLFG |
DOMAIN /note="SH3" DOMAIN /note="SH3" | ||
412 | F | - | - | - | - | RLFVW |
DOMAIN /note="SH3" DOMAIN /note="SH3" | ||
413 | Q | - | - | - | - | QVAEMRK |
DOMAIN /note="SH3" DOMAIN /note="SH3" | ||
414 | Q | - | - | - | - | EKDQR |
DOMAIN /note="SH3" DOMAIN /note="SH3" | ||
415 | Q | - | - | - | - | QRKWLE |
DOMAIN /note="SH3" DISORDER predicted by DISOPRED DOMAIN /note="SH3" | ||
416 | R | - | - | - | - | RKLEMQ |
DOMAIN /note="SH3" DOMAIN /note="SH3" | ||
417 | E | - | - | - | - | EAFLVDKRIT |
DOMAIN /note="SH3" DISORDER predicted by DISOPRED DOMAIN /note="SH3" | ||
418 | A | - | - | - | - | ASPRFWL |
DISORDER predicted by DISOPRED | ||
419 | M | - | - | - | - | LRVSCFTYMWAG |
DISORDER predicted by DISOPRED | ||
420 | K | - | - | - | - | RQKLEVDGITAMWFNPSY |
DISORDER predicted by DISOPRED | ||
421 | Q | - | - | - | - | RLKQAESYNGTDFIPV |
DISORDER predicted by DISOPRED | ||
422 | T | - | - | - | - | TASEKPRNVHMQDFGIL |
DISORDER predicted by DISOPRED | ||
423 | I | - | - | - | - | VLMQAIGSTWDKE |
DISORDER predicted by DISOPRED | ||
424 | E | - | - | - | - | EKSRGPQALDWFTV |
DISORDER predicted by DISOPRED | ||
425 | E | - | - | - | - | ERKATFSQNPDIGLV |
DISORDER predicted by DISOPRED | ||
426 | D | - | - | - | - | NTSDVLAGPIREFKQ |
DISORDER predicted by DISOPRED | ||
427 | K | - | - | - | - | KASNPREGLYVDIT |
DISORDER predicted by DISOPRED | ||
428 | E | - | - | - | - | GEQSDAKNRFILPTV |
DISORDER predicted by DISOPRED | ||
429 | P | - | - | - | - | PGDSALETFHKRINQV |
DISORDER predicted by DISOPRED | ||
430 | E | - | - | - | - | QGDNSEHLRTACPFIKVY |
DISORDER predicted by DISOPRED | ||
431 | K | - | - | - | - | RTKADFPSVGNQLEIY |
DISORDER predicted by DISOPRED | ||
432 | S | - | - | - | - | SARTEKNQLDFGIPVY |
DISORDER predicted by DISOPRED | ||
433 | G | - | - | - | - | GASFKTQRCHLDEINPVY |
DISORDER predicted by DISOPRED | ||
434 | K | - | - | - | - | EKDRSTLGQCVFMAINPY |
DISORDER predicted by DISOPRED | ||
435 | L | - | - | - | - | LFTSIRVDMQAEGKNPY |
DISORDER predicted by DISOPRED | ||
436 | W | - | - | - | - | WFSLDGREKYAINPQTV |
DISORDER predicted by DISOPRED | ||
437 | C | - | - | - | - | CSGARFLNPTY |
DISORDER predicted by DISOPRED | ||
438 | A | - | - | - | - | SAGRLQVDKNFM |
DISORDER predicted by DISOPRED | ||
439 | K | - | - | - | - | KRSAPIELTDGV |
DISORDER predicted by DISOPRED | ||
440 | K | - | - | - | - | KRFSLIDM |
DISORDER predicted by DISOPRED | ||
441 | N | - | - | - | - | NSGTKRDFLP |
DISORDER predicted by DISOPRED | ||
442 | K | - | - | - | - | KLRSGFVTNDEP |
DISORDER predicted by DISOPRED | ||
443 | K | - | - | - | - | KRQSEFGHVDNTY |
DISORDER predicted by DISOPRED | ||
444 | K | - | - | - | - | KGRFQYSCDEILT |
DISORDER predicted by DISOPRED | ||
445 | R | - | - | - | - | RSKETLHNDV |
DISORDER predicted by DISOPRED | ||
446 | K | - | - | - | - | KRLETDYNPACIV |
DISORDER predicted by DISOPRED | ||
447 | K | - | - | - | - | KERAFDSGHNP |
DISORDER predicted by DISOPRED | ||
448 | V | - | - | - | - | DVSMLFGYAHRPNEIKQT |
DISORDER predicted by DISOPRED | ||
449 | L | - | - | - | - | LMKFPSGTIQADERV |
DISORDER predicted by DISOPRED | ||
450 | Y | - | - | - | - | YSFTAHNQVIDEGKLPR |
DISORDER predicted by DISOPRED | ||
451 | N | - | - | - | - | ALETDKNGIMQFYPRSV |
DISORDER predicted by DISOPRED | ||
452 | A | - | - | - | - | ACLQRGSTDKV |
DISORDER predicted by DISOPRED | ||
453 | N | - | - | - | - | KGSTNPVDAERL |
DISORDER predicted by DISOPRED | ||
454 | K | - | - | - | - | KGHRSVEFADMNL |
DISORDER predicted by DISOPRED | ||
455 | N | - | - | - | - | SNQDEGRVFPL |
DISORDER predicted by DISOPRED | ||
456 | D | - | - | - | - | DSAEGTQLPIKNRV |
DISORDER predicted by DISOPRED | ||
457 | D | - | - | - | - | GQDIKSEALTHRVFNP |
DISORDER predicted by DISOPRED | ||
458 | Y | - | - | - | - | FYGRHNASMDEIKLPQTV |
DISORDER predicted by DISOPRED | ||
459 | D | - | - | - | - | DPSEQARVGKFILNT |
DISORDER predicted by DISOPRED | ||
460 | N | - | - | - | - | NSTQAERPGDL |
DISORDER predicted by DISOPRED | ||
461 | E | e | 29.1 | 4wsi_A | homo | ELDQYAHTKMP |
DISORDER predicted by DISOPRED | ||
462 | E | e | 87.4 | 4wsi_A | homo | EDSKQRVTAY |
DISORDER predicted by DISOPRED | ||
463 | I | e | 49.7 | 4wsi_A | homo | VILRMFAC |
DISORDER predicted by DISOPRED | ||
464 | L | e | 61.2 | 4wsi_A | homo | LVPMQIRTWA |
DISORDER predicted by DISOPRED | ||
465 | T | S | e | 90.3 | 4wsi_A | homo | TSVAILCG |
DISORDER predicted by DISOPRED | |
466 | Y | S | e | 88.7 | 4wsi_A | homo | YFLIQ |
DISORDER predicted by DISOPRED | |
467 | E | e | 48.2 | 4wsi_A | homo | ERFQL |
DISORDER predicted by DISOPRED | ||
468 | E | e | 61.8 | 4wsi_A | homo | EDPRKNTAGLSV |
DISORDER predicted by DISOPRED | ||
469 | M | E | e | 33.8 | 4wsi_A | homo | VMATNSCLDEGIKPR |
DISORDER predicted by DISOPRED | |
470 | S | E | b | 18.0 | 4wsi_A | SATVEGLNMIP |
|||
471 | L | E | e | 39.9 | 4wsi_A | LVFRKPTMADEGINQS |
|||
472 | Y | E | b | 19.1 | 4wsi_A | YLSVAEITWGDFHKMNPQR |
|||
473 | H | e | 64.9 | 4wsi_A | HRQSYAKNGLDEFIPTV |
||||
474 | Q | b | 10.2 | 4wsi_A | QRMESLKHDGIATV |
||||
475 | P | e | 36.4 | 4wsi_A | PETKRIVQADMSGLN |
||||
476 | A | T | e | 75.0 | 4wsi_A | ASVGPTDILQREHNK |
|||
477 | N | T | e | 58.8 | 4wsi_A | NDFGHSEIQRATCPVYKL |
|||
478 | R | S | e | 36.4 | 4wsi_A | RKYFQSAELPDGNV |
|||
479 | K | b | 13.7 | 4wsi_A | GKRPASVTEHQY |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |||
480 | R | b | 1.6 | 4wsi_A | RKLNQGMSTV |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |||
481 | P | b | 0.0 | 4wsi_A | LPTGIMVN |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |||
482 | I | E | b | 0.0 | 4wsi_A | VILFTYM |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
483 | I | E | b | 0.0 | 4wsi_A | VILTEMAF |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
484 | L | E | b | 0.0 | 4wsi_A | LIVFM |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
485 | I | E | b | 1.8 | 4wsi_A | SILFVTACM |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
486 | G | S | e | 21.4 | 4wsi_A | GAS |
BINDING /ligand="ATP" /ligand_id="ChEBI:CHEBI:30616" DOMAIN /note="Guanylate kinase-like" BINDING /ligand="ATP" /ligand_id="ChEBI:CHEBI:30616" DOMAIN /note="Guanylate kinase-like" | ||
487 | P | b | 1.6 | 4wsi_A | PAS |
BINDING /ligand="ATP" /ligand_id="ChEBI:CHEBI:30616" DOMAIN /note="Guanylate kinase-like" BINDING /ligand="ATP" /ligand_id="ChEBI:CHEBI:30616" DOMAIN /note="Guanylate kinase-like" | |||
488 | Q | T | e | 60.7 | 4wsi_A | hetero CRB_DROME | SILVATMQEHP |
BINDING /ligand="ATP" /ligand_id="ChEBI:CHEBI:30616" DOMAIN /note="Guanylate kinase-like" BINDING /ligand="ATP" /ligand_id="ChEBI:CHEBI:30616" DOMAIN /note="Guanylate kinase-like" | |
489 | N | T | e | 60.0 | 4wsi_A | GAKNELSVDFHIMPQRTY |
BINDING /ligand="ATP" /ligand_id="ChEBI:CHEBI:30616" DOMAIN /note="Guanylate kinase-like" BINDING /ligand="ATP" /ligand_id="ChEBI:CHEBI:30616" DOMAIN /note="Guanylate kinase-like" | ||
490 | C | T | b | 4.0 | 4wsi_A | VATCSDGELFHIKMNPQRY |
BINDING /ligand="ATP" /ligand_id="ChEBI:CHEBI:30616" DOMAIN /note="Guanylate kinase-like" BINDING /ligand="ATP" /ligand_id="ChEBI:CHEBI:30616" DOMAIN /note="Guanylate kinase-like" | ||
491 | G | T | b | 10.7 | 4wsi_A | GRAEHLSVDFIKMNPQTY |
BINDING /ligand="ATP" /ligand_id="ChEBI:CHEBI:30616" DOMAIN /note="Guanylate kinase-like" BINDING /ligand="ATP" /ligand_id="ChEBI:CHEBI:30616" DOMAIN /note="Guanylate kinase-like" | ||
492 | Q | H | b | 6.1 | 4wsi_A | KALRQV |
BINDING /ligand="ATP" /ligand_id="ChEBI:CHEBI:30616" DOMAIN /note="Guanylate kinase-like" BINDING /ligand="ATP" /ligand_id="ChEBI:CHEBI:30616" DOMAIN /note="Guanylate kinase-like" | ||
493 | N | H | e | 50.3 | 4wsi_A | hetero CRB_DROME | SDTGNRHAKL |
BINDING /ligand="ATP" /ligand_id="ChEBI:CHEBI:30616" DOMAIN /note="Guanylate kinase-like" BINDING /ligand="ATP" /ligand_id="ChEBI:CHEBI:30616" DOMAIN /note="Guanylate kinase-like" | |
494 | E | H | e | 51.8 | 4wsi_A | TSEVIAHRDL |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
495 | L | H | b | 0.0 | 4wsi_A | LVIAFGS |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
496 | R | H | e | 22.1 | 4wsi_A | hetero CRB_DROME | VRIKALMNCESTDGPQ |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |
497 | Q | H | e | 46.9 | 4wsi_A | hetero CRB_DROME | KERQNSADHGVLT |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |
498 | R | H | e | 29.2 | 4wsi_A | AKRMEDLQTGHVCFINSY |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
499 | L | H | b | 0.0 | 4wsi_A | LIVKMACFTW |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
500 | M | H | e | 21.3 | 4wsi_A | LAIVFTMRYCEPQS |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
501 | N | H | e | 70.3 | 4wsi_A | ESNRADKTQGVILHM |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
502 | K | H | e | 64.6 | 4wsi_A | EQKRDTSAINGLWCFHMPVY |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
503 | E | T | e | 23.6 | 4wsi_A | EDFAKNHMPQRLVISTYCG |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
504 | K | T | e | 27.4 | 4wsi_A | PKDSTELMNQAFGHRVCIY |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
505 | D | T | e | 75.3 | 4wsi_A | DESLNTGPQAHFIRVY |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
506 | R | T | e | 21.7 | 4wsi_A | KRIQLDENAGHSVPTYCM |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
507 | F | E | b | 2.4 | 4wsi_A | FLYIVMQWHKNRS |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
508 | A | E | b | 18.8 | 4wsi_A | QAGERTCVKSLFHYDIMNW |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
509 | S | e | 50.8 | 4wsi_A | hetero CRB_DROME | ISYLFRTVQKADEGHMP |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
510 | A | b | 8.0 | 4wsi_A | SACLTGPEIVDKR |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |||
511 | V | b | 20.0 | 4wsi_A | VIPKALNTRCDEFGQSY |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |||
512 | P | e | 20.9 | 4wsi_A | hetero CRB_DROME | SPLECTADFGIKNQRVY |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
513 | H | E | b | 12.0 | 4wsi_A | HAEKYDVMFLTCSGINPQRW |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
514 | T | E | b | 0.0 | 4wsi_A | TEPVLFCSADGIKNQR |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
515 | T | b | 11.7 | 4wsi_A | TSRMIADEFGKLNPQVY |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |||
516 | R | S | b | 9.5 | 4wsi_A | hetero CRB_DROME | RKDVMAEFGILNPQSTY |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |
517 | S | e | 79.7 | 4wsi_A | APSKQEGTDFILNRVHY |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |||
518 | R | e | 53.8 | 4wsi_A | PKRGMAQIVDEFLNST |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |||
519 | R | e | 54.9 | 4wsi_A | hetero CRB_DROME | RTKSYADEFGILNPQV |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
520 | D | T | e | 95.1 | 4wsi_A | DPESKGFALNQRVCHIT |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
521 | Q | T | e | 93.9 | 4wsi_A | GPQYSEKADNHLMTFIRV |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
522 | E | b | 16.6 | 4wsi_A | DEKRALFGINPQSTVY |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |||
523 | V | e | 44.7 | 4wsi_A | VIQDREKSTAGMLNCHP |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |||
524 | A | T | e | 51.8 | 4wsi_A | DENHAPSGIKLQRTV |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
525 | G | T | e | 52.4 | 4wsi_A | GRADSEIKLNPTV |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
526 | R | T | e | 63.2 | 4wsi_A | hetero CRB_DROME | VKREQISTLADFGHMNP |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |
527 | D | T | e | 27.2 | 4wsi_A | hetero CRB_DROME | DHENSAGLFIKPQRTVY |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |
528 | Y | e | 26.1 | 4wsi_A | hetero CRB_DROME | YHLADEFGIKNPQRSTV |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
529 | H | E | e | 30.9 | 4wsi_A | HFYRNISAKLVDEGPQTW |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
530 | F | E | e | 20.6 | 4wsi_A | FYLADEGIKNPQRSTV |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
531 | V | e | 25.3 | 4wsi_A | VILKRTQMACDEFGHNPS |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |||
532 | S | e | 58.6 | 4wsi_A | STDAEINPGKLQRV |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |||
533 | R | H | e | 21.3 | 4wsi_A | RKVEQAPHDINTGLMS |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
534 | Q | H | e | 50.0 | 4wsi_A | EDAQKSTGHLPRINV |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
535 | A | H | e | 32.1 | 4wsi_A | EATQVRKDLSCGHIMNP |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
536 | F | H | b | 0.0 | 4wsi_A | FMIELADGKNPQRSTVY |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
537 | E | H | b | 6.5 | 4wsi_A | EKQRDLAIPTVHMCGNSW |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
538 | A | H | e | 37.5 | 4wsi_A | AREKQTSDNGCHILMPVY |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
539 | D | H | b | 17.3 | 4wsi_A | LMDGRKAEQSCINPTVW |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
540 | I | H | e | 24.6 | 4wsi_A | IVLRAECGKTDFHMNPQS |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
541 | A | H | e | 55.4 | 4wsi_A | ADEKSQGNRFHLTVY |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
542 | A | T | e | 60.7 | 4wsi_A | ASENDQKPRGMHTCIL |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
543 | G | T | e | 52.4 | 4wsi_A | GNDSECHKALQRV |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
544 | K | e | 47.2 | 4wsi_A | EKDAGQLIRFNCHMSTVY |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |||
545 | F | E | b | 4.8 | 4wsi_A | FLIMYACGSV |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
546 | I | E | b | 1.8 | 4wsi_A | LIVRAFGMSY |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
547 | E | E | e | 20.1 | 4wsi_A | hetero CRB_DROME | EKLDAGSV |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |
548 | H | E | e | 39.3 | 4wsi_A | WYHSAFTVCDEGIKLNPQR |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
549 | G | E | e | 38.1 | 4wsi_A | hetero CRB_DROME | AGKEVFTLNSDIPQRY |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |
550 | E | E | e | 27.1 | 4wsi_A | EKQRSTLNFGHAMVYCDIP |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
551 | F | E | e | 55.5 | 4wsi_A | hetero CRB_DROME | VYFILRHASDEGKNPQT |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |
552 | E | T | e | 52.3 | 4wsi_A | FHEYASVGKQLNCDIPRT |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
553 | K | T | e | 42.9 | 4wsi_A | GDNKESRTAILPQV |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
554 | N | E | e | 25.5 | 4wsi_A | NHSDEGRAQTYIKLPV |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
555 | L | E | b | 4.5 | 4wsi_A | YFLSRCMKWHINADEGPQTV |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
556 | Y | E | b | 16.5 | 4wsi_A | hetero CRB_DROME | YGDKFSAEHILNPQRTV |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |
557 | G | E | b | 6.0 | 4wsi_A | GVADEIKLNPRST |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
558 | T | E | b | 14.3 | 4wsi_A | hetero CRB_DROME | TVLISADEGKNPR |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |
559 | S | E | b | 4.7 | 4wsi_A | SPLRAKNTEGI |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
560 | I | H | b | 14.0 | 4wsi_A | RKLVIAFQTEGHMY |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
561 | D | H | e | 54.9 | 4wsi_A | DAEKSQNGPRTVHL |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
562 | S | H | b | 4.7 | 4wsi_A | PTSAEQYWVFDGHIKNR |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
563 | V | H | b | 0.0 | 4wsi_A | VILASTM |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
564 | R | H | e | 30.0 | 4wsi_A | ERKQDLNHMAFISTV |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
565 | Q | H | e | 68.4 | 4wsi_A | EQKADRGNTVPSFILMY |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
566 | V | H | b | 10.7 | 4wsi_A | IAVQTLRKMNEFGHY |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
567 | I | H | b | 11.1 | 4wsi_A | LIAMTHRVWEFQS |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
568 | N | T | e | 52.7 | 4wsi_A | AEDKNSQRTGHILV |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
569 | S | T | e | 57.0 | 4wsi_A | QKASERDTNLVHM |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
570 | G | T | e | 34.5 | 4wsi_A | GDNEKSV |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
571 | K | S | e | 30.7 | 4wsi_A | KRIQHLVEFNCDGMPSTY |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
572 | I | E | b | 3.5 | 4wsi_A | DHINVPSATEKLRW |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
573 | C | E | b | 0.0 | 4wsi_A | VACLIMSPT |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
574 | L | E | b | 3.9 | 4wsi_A | LIVFCM |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
575 | L | E | b | 9.0 | 4wsi_A | LFIVAMCD |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
576 | S | E | e | 20.3 | 4wsi_A | hetero CRB_DROME | DEVHSCIKNR |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |
577 | L | b | 4.5 | 4wsi_A | hetero CRB_DROME | IVLMDN |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
578 | R | e | 44.3 | 4wsi_A | hetero CRB_DROME | DETANSQVHR |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
579 | T | G | e | 35.7 | 4wsi_A | WPVLTIYGACFKM |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
580 | Q | G | e | 37.2 | 4wsi_A | QENKHSADFGLRTVY |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
581 | S | G | b | 7.0 | 4wsi_A | GADTSKQ |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
582 | L | H | b | 3.9 | 4wsi_A | AVLIMFTGHR |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
583 | K | H | e | 21.7 | 4wsi_A | RKQDELANHTFIM |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
584 | T | H | e | 36.4 | 4wsi_A | QRSVLKANTHIEFG |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
585 | L | H | b | 0.0 | 4wsi_A | LVIKAFMTY |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
586 | R | H | b | 10.3 | 4wsi_A | RKNQHAGYDEILT |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
587 | N | T | e | 69.1 | 4wsi_A | KYETANSQRDGHIVLM |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
588 | S | S | b | 15.6 | 4wsi_A | KASTLVQIMRGNCFHPYDE |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
589 | D | T | e | 61.1 | 4wsi_A | QMFEYDALGHIKNRSVPCT |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
590 | L | T | b | 2.2 | 4wsi_A | PLFIWYADKSEMQRVGNT |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
591 | K | b | 17.9 | 4wsi_A | DEYKNQGARSFPHVMT |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |||
592 | P | b | 0.8 | 4wsi_A | PAGVDSKTCELNQW |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |||
593 | Y | E | b | 2.2 | 4wsi_A | IVYLRKFHATCEMNQS |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
594 | I | E | b | 0.6 | 4wsi_A | VSFTYLIAGQEMR |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
595 | I | E | b | 0.0 | 4wsi_A | IVLF |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
596 | F | E | b | 4.8 | 4wsi_A | FLYI |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
597 | I | E | b | 0.0 | 4wsi_A | ILVFC |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
598 | A | E | b | 6.2 | 4wsi_A | LAKNQRVISTHMCDE |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
599 | P | b | 10.1 | 4wsi_A | PATYE |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |||
600 | P | b | 9.3 | 4wsi_A | PDKEMTSAGR |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |||
601 | S | e | 57.8 | 4wsi_A | SDNTCEAIKR |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |||
602 | Q | H | e | 32.1 | 4wsi_A | LKIMRQFWAVENTY |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
603 | E | H | e | 38.2 | 4wsi_A | EDQAKSTPGHLNRV |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
604 | R | H | e | 56.5 | 4wsi_A | EADGVKRTHIMNSLPQ |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
605 | L | H | b | 4.5 | 4wsi_A | LVIYMKRT |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
606 | R | H | e | 23.3 | 4wsi_A | ERKQVLADHIMYFNST |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
607 | A | H | e | 74.1 | 4wsi_A | REAKTQNGSDCHLFIV |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
608 | L | H | e | 61.2 | 4wsi_A | RLMIYKPT |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
609 | L | e | 72.5 | 4wsi_A | LIADRSVYEGKMNPQT |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |||
610 | A | - | - | - | - | RIKTAEQSVCHLNDGYFMP |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
611 | K | - | - | - | - | GKRNPESTALQDHCFIVY |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
612 | E | - | - | - | - | REDAKLQSGHINPTV |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
613 | G | - | - | - | - | GSANRDQTEIKLPW |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
614 | K | - | - | - | - | TQRKLSEADPIMVY |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
615 | N | - | - | - | - | DENTRSAGFKLQV |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
616 | P | e | 116.3 | 4wsi_B | STPEADLQRFKNVGIMY |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |||
617 | K | e | 28.3 | 4wsi_B | EDKTARQNSPLMFGHIV |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |||
618 | P | H | e | 93.8 | 4wsi_B | EDASPTQNILVGKFHMRY |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
619 | E | H | e | 34.2 | 4wsi_B | EVKADRSQTIFGHLMNP |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
620 | E | e | 52.8 | 4wsi_A | hetero VEMP_SARS2 | IESVDQALHRTKGMN |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
621 | L | H | e | 42.1 | 4wsi_A | LAISVEQTFRDKMGN |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
622 | R | H | e | 30.8 | 4wsi_A | RKQAEINSVFHLDGMPT |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
623 | E | H | e | 32.7 | 4wsi_A | REKDQAVGSCHILMNT |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
624 | I | H | e | 23.4 | 4wsi_A | LRIMVTQADFS |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
625 | I | H | e | 66.1 | 4wsi_A | LIAYVFREMQSDGKNT |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
626 | E | H | e | 23.1 | 4wsi_A | EADKQNLMRSTCGHVY |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
627 | K | H | b | 8.0 | 4wsi_A | ARKQELSTDGHV |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
628 | T | H | e | 27.3 | 4wsi_A | ASRMTVNYGKQECHIL |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
629 | R | H | e | 36.4 | 4wsi_A | ARKQESNDHGIMVLTWY |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
630 | E | H | b | 10.6 | 4wsi_A | EKRADQFLMVGHIPSTY |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
631 | M | H | e | 20.8 | 4wsi_A | ILMAVEFKYDNTCGHQRS |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
632 | E | T | e | 63.8 | 4wsi_A | ERQKSADNILMVT |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
633 | Q | T | e | 33.2 | 4wsi_A | QILKSAMRHEVDNCFGTY |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
634 | N | G | e | 29.1 | 4wsi_A | EASNQHTGKLRDIMVYFW |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
635 | N | G | e | 81.8 | 4wsi_A | YHAFNSDIECKLMVRGPQTW |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
636 | G | G | e | 38.1 | 4wsi_A | AGSELNPQWHRCFIKMTVDY |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
637 | H | e | 63.4 | 4wsi_A | homo | HDEGSRPNQAKLYFITV |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
638 | Y | e | 26.1 | 4wsi_A | YLEKFQADRWHNCGIPSTV |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |||
639 | F | S | b | 8.1 | 4wsi_A | FYACHIV |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
640 | D | S | e | 32.1 | 4wsi_A | DTEKNGPQRS |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
641 | T | E | e | 27.3 | 4wsi_A | YATFHLKVEGRIQ |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
642 | A | E | e | 45.5 | 4wsi_A | VITLAEKQSCNRW |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
643 | I | E | b | 4.1 | 4wsi_A | IVLF |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
644 | V | E | e | 58.0 | 4wsi_A | VILTNQEFSY |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
645 | N | b | 10.9 | 4wsi_A | NGAQREHK |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |||
646 | S | S | e | 30.5 | 4wsi_A | DEGSNHAQRTK |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
647 | D | S | e | 50.6 | 4wsi_A | DNETSAKVHMQRGL |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
648 | L | H | e | 25.3 | 4wsi_A | LFVINSMPAY |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
649 | D | H | e | 56.8 | 4wsi_A | DENSQATHKPGV |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
650 | K | H | e | 29.7 | 4wsi_A | ETKRQDSVGNALHIP |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
651 | A | H | b | 2.7 | 4wsi_A | ATSWICV |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
652 | Y | H | b | 0.9 | 4wsi_A | YLVFACIKEHRS |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
653 | Q | H | e | 54.6 | 4wsi_A | AEQSNKGDTRHMFLVY |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
654 | E | H | e | 33.7 | 4wsi_A | EQDKARSHTVILN |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
655 | L | H | b | 0.0 | 4wsi_A | LIVFMTAC |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
656 | L | H | b | 6.2 | 4wsi_A | KLERVQISHACDMNTWY |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
657 | R | H | e | 43.1 | 4wsi_A | SATEKQRDHLNCGV |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
658 | L | H | b | 2.8 | 4wsi_A | ILVATMSFRY |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
659 | I | H | b | 1.2 | 4wsi_A | IVLFMATY |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
660 | N | H | e | 36.4 | 4wsi_A | EQSDNRHTKAGLW |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
661 | K | T | e | 27.8 | 4wsi_A | KQRESDHAILNT |
|||
662 | L | T | b | 1.1 | 4wsi_A | LQFAIEVNRYP |
|||
663 | D | T | e | 42.6 | 4wsi_A | QRSDEKCLTPANH |
|||
664 | T | T | e | 79.9 | 4wsi_A | TGNSLEAKMQRDHIP |
|||
665 | E | S | e | 44.2 | 4wsi_A | EQTAKDPRSHIY |
|||
666 | P | e | 30.2 | 4wsi_A | PKTALGYVFHRE |
||||
667 | Q | E | b | 14.3 | 4wsi_A | QIVHLKRYF |
|||
668 | W | E | e | 61.0 | 4wsi_A | homo | WLS |
||
669 | V | E | b | 0.7 | 4wsi_A | VITDGL |
|||
670 | P | E | b | 7.0 | 4wsi_A | PR |
|||
671 | S | G | b | 3.1 | 4wsi_A | VASIQEY |
|||
672 | T | G | e | 66.2 | 4wsi_A | SCTGAI |
|||
673 | W | G | b | 13.5 | 4wsi_A | WP |
|||
674 | L | T | e | 41.0 | 4wsi_A | VLI |
|||
675 | R | e | 84.2 | 4wsi_A | RQ |