#WARNING:no index is registered index "YP_009725304.1" in "https://rest.uniprot.org/uniprotkb/" url "https://rest.uniprot.org/uniprotkb/YP_009725304.1.txt".
Please visit the UniProt website(https://www.uniprot.org), and get a proper ID/AC for your query protein.

[All Sites]

Contact Molecules for Homologous Proteins


[Summary Bars]

[Full Bars]


Sites by Variants[80 %]


[Back to Search Page]

[Back to HOMCOS]

[SupCon3D]

[help]
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
20796 198 144 YP_009725304.1()
QUERYSEQ
AIASEFSSLPSYAAFATAQEAYEQAVANGDSEVVLKKLKKSLNVAKSEFDRDAAMQRKLEKMADQAMTQMYKQARSEDKRAKVTSAMQTMLFTMLRKLDNDALNNIINNARDGCVPLNIIPLTTAAKLMVVIPDYNTYKNTCDGTTFTYA
SALWEIQQVVDADSKIVQLSEISMDNSPNLAWPLIVTALRANSAVKLQ
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

Statistics of sites in view of Disease classification

All
Number of sites 198
Buired or ExposedBuried 18.3 (%) [36]
Exposed 81.7 (%) [161]
Ave relacc 45.9 %
SD relacc 23.98 %
Contact Molhetero 51.0 (%) [101]
nucleotide 10.6 (%) [21]
compound 1.5 (%) [3]
metal 0.0 (%) [0]
otherpoly 0.0 (%) [0]
homo 29.3 (%) [58]
precipitant 14.1 (%) [28]
Number of variants 0
N_Freq(AAvariant)==0 %
N_Freq(AAvariant)>0 %
Ave Freq(AAvariant)
SD Freq(AAvariant)