Contact Molecules for Homologous Proteins | ||||
![]() [Summary Bars] |
![]() [Full Bars] |
|
![]() [Back to Search Page] |
![]() [Back to HOMCOS] |
![]() [Sites by Variants] |
![]() [SupCon3D] |
![]() [help] |
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100] | ![]() [show] [download] [help] |
PID | QueryLength | Homolgous Sequence in PDB | UniProt Query | TITLE |
1598604 | 675 | 24 | Q8N3R9(PALS1_HUMAN) | RecName: Full=Protein PALS1 ;AltName: Full=MAGUK p55 subfamily member 5;AltName: Full=Membrane protein, palmitoylated 5 ;AltName: Full=Protein associated with Lin-7 1 ; |
QUERYSEQ |
MTTSHMNGHVTEESDSEVKNVDLASPEEHQKHREMAVDCPGDLGTRMMPIRRSAQLERIRQQQEDMRRRREEEGKKQELDLNSSMRLKKLAQIPPKTGIDNPMFDTEEGIVLESPHYAVKILEIEDLFSSLKHIQHTLVDSQSQEDISLL LQLVQNKDFQNAFKIHNAITVHMNKASPPFPLISNAQDLAQEVQTVLKPVHHKEGQELTALLNTPHIQALLLAHDKVAEQEMQLEPITDERVYESIGQYGGETVKIVRIEKARDIPLGATVRNEMDSVIISRIVKGGAAEKSGLLHEGDE VLEINGIEIRGKDVNEVFDLLSDMHGTLTFVLIPSQQIKPPPAKETVIHVKAHFDYDPSDDPYVPCRELGLSFQKGDILHVISQEDPNWWQAYREGDEDNQPLAGLVPGKSFQQQREAMKQTIEEDKEPEKSGKLWCAKKNKKKRKKVLY NANKNDDYDNEEILTYEEMSLYHQPANRKRPIILIGPQNCGQNELRQRLMNKEKDRFASAVPHTTRSRRDQEVAGRDYHFVSRQAFEADIAAGKFIEHGEFEKNLYGTSIDSVRQVINSGKICLLSLRTQSLKTLRNSDLKPYIIFIAPP SQERLRALLAKEGKNPKPEELREIIEKTREMEQNNGHYFDTAIVNSDLDKAYQELLRLINKLDTEPQWVPSTWLR |
[n]:site number of query sequence. [a]:amino acid of query sequence. [s]:predicted secondary structure. [e]:predicted exposed/buried. [acc]:predicted relative accesssibility(%). [pdb]:PDB code of homologous structure. [contact_mols]:predicted binding molecules [observed aa]:Observed amino acids among homologous sequences. [feature table]:UniProt Feature Table [variant]:UniProt Human Variant.
n | a | s | e | acc | pdb | contact_mols | observed aa | feature table | variant |
![]() | M | - | - | - | - | M |
REGION /note="Disordered" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED REGION /note="Disordered" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | T | - | - | - | - | T |
REGION /note="Disordered" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED REGION /note="Disordered" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | T | - | - | - | - | T |
REGION /note="Disordered" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED REGION /note="Disordered" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | S | - | - | - | - | S |
REGION /note="Disordered" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED REGION /note="Disordered" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | H | - | - | - | - | H |
REGION /note="Disordered" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED REGION /note="Disordered" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | M | - | - | - | - | M |
REGION /note="Disordered" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED REGION /note="Disordered" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | N | - | - | - | - | N |
REGION /note="Disordered" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED REGION /note="Disordered" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | G | - | - | - | - | G |
REGION /note="Disordered" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED REGION /note="Disordered" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | H | - | - | - | - | HY |
REGION /note="Disordered" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED REGION /note="Disordered" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | V | - | - | - | - | V |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" COMPBIAS /note="Basic and acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | T | - | - | - | - | T |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" COMPBIAS /note="Basic and acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | E | - | - | - | - | E |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" COMPBIAS /note="Basic and acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | E | - | - | - | - | ES |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" COMPBIAS /note="Basic and acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | S | - | - | - | - | SD |
MOD_RES /note="Phosphoserine" COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" MOD_RES /note="Phosphoserine" COMPBIAS /note="Basic and acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | D | - | - | - | - | DG |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" COMPBIAS /note="Basic and acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | S | - | - | - | - | SG |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" COMPBIAS /note="Basic and acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | E | - | - | - | - | EAGLSDIKNPQRTVCFHMY |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" COMPBIAS /note="Basic and acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | V | - | - | - | - | VAGLSDEIKNPQRTCFHMY |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" COMPBIAS /note="Basic and acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | K | - | - | - | - | KG |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" COMPBIAS /note="Basic and acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | N | - | - | - | - | NG |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" COMPBIAS /note="Basic and acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | V | - | - | - | - | VT |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" COMPBIAS /note="Basic and acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | D | - | - | - | - | D |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" COMPBIAS /note="Basic and acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | L | - | - | - | - | LI |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" COMPBIAS /note="Basic and acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | A | - | - | - | - | AV |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" COMPBIAS /note="Basic and acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | S | - | - | - | - | SE |
MOD_RES /note="Phosphoserine" ECO:0007744|PubMed:23186163" COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" MOD_RES /note="Phosphoserine" ECO:0007744|PubMed:23186163" COMPBIAS /note="Basic and acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | P | - | - | - | - | PAGLSDEIKNQRTVCFHMY |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" COMPBIAS /note="Basic and acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | E | - | - | - | - | E |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" COMPBIAS /note="Basic and acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | E | - | - | - | - | EG |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" COMPBIAS /note="Basic and acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | H | - | - | - | - | HV |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" COMPBIAS /note="Basic and acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | Q | - | - | - | - | Q |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | K | - | - | - | - | KR |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | H | - | - | - | - | H |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | R | - | - | - | - | R |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | E | - | - | - | - | E |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | M | - | - | - | - | M |
REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | A | - | - | - | - | A |
REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | V | - | - | - | - | V |
REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | D | - | - | - | - | D |
REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | C | - | - | - | - | C |
REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | P | - | - | - | - | P |
REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | G | - | - | - | - | GS |
REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | D | - | - | - | - | DE |
REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | L | - | - | - | - | L |
REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | G | - | - | - | - | G |
REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | T | - | - | - | - | TA |
REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | R | - | - | - | - | R |
REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | M | - | - | - | - | MT |
REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | M | - | - | - | - | ML |
REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | P | - | - | - | - | P |
REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | I | - | - | - | - | IV |
REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | R | - | - | - | - | R |
REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | R | - | - | - | - | RD |
REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | S | - | - | - | - | SR |
REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | A | - | - | - | - | AD |
REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | Q | - | - | - | - | QK |
REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | L | - | - | - | - | L |
REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | E | - | - | - | - | EQ |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | R | - | - | - | - | RK |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | I | - | - | - | - | IL |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | R | - | - | - | - | RA |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | Q | - | - | - | - | QD |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | Q | - | - | - | - | QT |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | Q | - | - | - | - | QV |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | E | - | - | - | - | E |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | D | - | - | - | - | DE |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | M | - | - | - | - | MLR |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | R | - | - | - | - | RK |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | R | - | - | - | - | R |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | R | - | - | - | - | R |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | R | - | - | - | - | RE |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | E | - | - | - | - | EK |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | E | - | - | - | - | EL |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | E | - | - | - | - | EKG |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | G | - | - | - | - | GR |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | K | - | - | - | - | KAS |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | K | - | - | - | - | KVR |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | Q | - | - | - | - | Q |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | E | - | - | - | - | EA |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | L | - | - | - | - | LI |
REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | D | - | - | - | - | DA |
REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | L | - | - | - | - | LG |
REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | N | - | - | - | - | NG |
REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | S | - | - | - | - | ST |
MOD_RES /note="Phosphoserine" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" MOD_RES /note="Phosphoserine" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | S | - | - | - | - | SN |
MOD_RES /note="Phosphoserine" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" MOD_RES /note="Phosphoserine" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | M | - | - | - | - | M |
REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | R | - | - | - | - | RD |
REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | L | - | - | - | - | L |
REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | K | - | - | - | - | KY |
REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | K | - | - | - | - | KA |
REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | L | - | - | - | - | LT |
REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | A | - | - | - | - | ADS |
REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | Q | - | - | - | - | QA |
REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | I | - | - | - | - | IDAGLSEFHKMNPQRTVY |
REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | P | - | - | - | - | PMN |
REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | P | - | - | - | - | P |
REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | K | - | - | - | - | KI |
REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | T | - | - | - | - | TV |
REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | G | - | - | - | - | G |
REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | I | - | - | - | - | IA |
REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | D | - | - | - | - | DT |
REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | N | - | - | - | - | ND |
REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | P | - | - | - | - | PE |
REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | M | - | - | - | - | MWT |
REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | F | - | - | - | - | FA |
REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | D | - | - | - | - | DE |
REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | T | - | - | - | - | TEQ |
REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | E | - | - | - | - | EM |
REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | E | - | - | - | - | EA |
REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | G | - | - | - | - | G |
REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | I | - | - | - | - | IP |
REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | V | - | - | - | - | VEG |
REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | L | - | - | - | - | LAGSDEIKNPQRTVCFHMWY |
REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | E | - | - | - | - | EQAGLSDIKNPRTVCFHMWY |
REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | S | - | - | - | - | SAGLDEIKNPQRTVCFHMWY |
REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | P | - | - | - | - | PLAGSDEIKNQRTVCFHMWY |
REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | H | - | - | - | - | HIAGLSDEKNPQRTVCFMWY |
REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | Y | - | - | - | - | YAGLSDEIKNPQRTVCFHMW |
REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | A | - | - | - | - | APGLSDEIKNQRTVCFHMWY |
REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | V | S | e | 70.7 | ![]() |
precipitant | VPAGLSDEIKNQRTCFHMWY |
REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
![]() | K | e | 47.6 | ![]() |
hetero MPDZ_RAT | AK |
DOMAIN /note="L27 1" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="L27 1" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | I | e | 21.6 | ![]() |
hetero MPDZ_RAT | IVL |
DOMAIN /note="L27 1" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="L27 1" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | L | b | 0.0 | ![]() |
hetero MPDZ_RAT | LQ |
DOMAIN /note="L27 1" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="L27 1" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | E | e | 46.7 | ![]() |
ER |
DOMAIN /note="L27 1" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="L27 1" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |||
![]() | I | H | b | 10.5 | ![]() |
IVL |
DOMAIN /note="L27 1" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="L27 1" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | E | H | e | 46.7 | ![]() |
ESL |
DOMAIN /note="L27 1" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="L27 1" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | D | H | e | 33.3 | ![]() |
hetero INADL_HUMAN MPDZ_RAT | DQ |
DOMAIN /note="L27 1" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="L27 1" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
![]() | L | H | b | 0.0 | ![]() |
hetero INADL_HUMAN MPDZ_RAT | LVC |
DOMAIN /note="L27 1" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="L27 1" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
![]() | F | H | e | 33.5 | ![]() |
LF |
DOMAIN /note="L27 1" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="L27 1" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | S | H | e | 39.1 | ![]() |
DSM |
DOMAIN /note="L27 1" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="L27 1" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | S | H | b | 0.0 | ![]() |
hetero INADL_HUMAN MPDZ_RAT | SD |
DOMAIN /note="L27 1" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="L27 1" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
![]() | L | H | b | 2.8 | ![]() |
LI |
DOMAIN /note="L27 1" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="L27 1" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | K | H | e | 69.3 | ![]() |
KEY |
DOMAIN /note="L27 1" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="L27 1" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | H | H | e | 33.5 | ![]() |
hetero INADL_HUMAN MPDZ_RAT | HESQ |
DOMAIN /note="L27 1" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="L27 1" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
![]() | I | H | b | 0.0 | ![]() |
hetero INADL_HUMAN MPDZ_RAT | ILV |
DOMAIN /note="L27 1" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="L27 1" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
![]() | Q | H | e | 45.4 | ![]() |
QAEGLSVDFHIKMNPRTY |
DOMAIN /note="L27 1" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="L27 1" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | H | H | e | 83.8 | ![]() |
HD |
DOMAIN /note="L27 1" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="L27 1" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | T | H | b | 15.6 | ![]() |
hetero INADL_HUMAN MPDZ_RAT | ATS |
DOMAIN /note="L27 1" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED DOMAIN /note="L27 1" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
![]() | L | b | 0.6 | ![]() |
hetero INADL_HUMAN MPDZ_RAT | LH |
DOMAIN /note="L27 1" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="L27 1" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | V | e | 75.3 | ![]() |
VTNI |
DOMAIN /note="L27 1" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="L27 1" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |||
![]() | D | S | e | 30.2 | ![]() |
hetero INADL_HUMAN MPDZ_RAT | D |
DOMAIN /note="L27 1" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED DOMAIN /note="L27 1" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
![]() | S | H | e | 67.2 | ![]() |
SCA |
DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | Q | H | e | 42.3 | ![]() |
hetero INADL_HUMAN MPDZ_RAT | QNDEAFGIKLPRSTVY |
DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
![]() | S | H | b | 0.0 | ![]() |
hetero INADL_HUMAN MPDZ_RAT | SHV |
DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
![]() | Q | H | e | 35.2 | ![]() |
QELRKP |
DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | E | H | e | 54.8 | ![]() |
EKRD |
DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | D | H | b | 4.9 | ![]() |
hetero INADL_HUMAN MPDZ_RAT | DE |
DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
![]() | I | H | b | 0.6 | ![]() |
hetero INADL_HUMAN MPDZ_RAT | LVMIRADEGKNPQST |
DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
![]() | S | H | e | 51.6 | ![]() |
TSCGDEAIKLNPQRV |
DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | L | H | e | 32.0 | ![]() |
hetero MPDZ_RAT | FLADEGIKNPQRSTV |
DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
![]() | L | H | b | 0.0 | ![]() |
hetero INADL_HUMAN MPDZ_RAT | LMV |
DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
![]() | L | H | e | 27.5 | ![]() |
LWHRY |
DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | Q | H | e | 73.5 | ![]() |
DQRSA |
DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | L | H | e | 25.8 | ![]() |
hetero INADL_HUMAN MPDZ_RAT | LVMD |
DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
![]() | V | H | b | 0.0 | ![]() |
hetero MPDZ_RAT | FVLN |
DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
![]() | Q | H | e | 54.6 | ![]() |
QGHSR |
DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | N | e | 41.8 | ![]() |
hetero MPDZ_RAT | ESNLDK |
DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | K | H | e | 67.5 | ![]() |
homo | KPHQR |
DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
![]() | D | H | e | 25.3 | ![]() |
hetero INADL_HUMAN MPDZ_RAT homo | SWDQHG |
DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
![]() | F | H | b | 1.0 | ![]() |
hetero INADL_HUMAN MPDZ_RAT | LF |
DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
![]() | Q | H | e | 24.0 | ![]() |
HQLSG |
DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | N | H | e | 50.3 | ![]() |
hetero INADL_HUMAN MPDZ_RAT homo | SAYNQTK |
DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
![]() | A | H | b | 0.0 | ![]() |
hetero INADL_HUMAN MPDZ_RAT | LA |
DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
![]() | F | H | b | 0.0 | ![]() |
hetero INADL_HUMAN MPDZ_RAT | FLVM |
DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
![]() | K | H | e | 56.1 | ![]() |
homo | KDS |
DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
![]() | I | H | b | 9.4 | ![]() |
hetero INADL_HUMAN MPDZ_RAT homo precipitant | IRLV |
DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
![]() | H | H | b | 0.0 | ![]() |
hetero INADL_HUMAN MPDZ_RAT | HYI |
DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
![]() | N | H | b | 10.9 | ![]() |
EDNA |
DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | A | H | e | 32.1 | ![]() |
homo precipitant | KACS |
DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
![]() | I | H | b | 1.2 | ![]() |
hetero INADL_HUMAN MPDZ_RAT homo | LITV |
DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
![]() | T | H | b | 1.3 | ![]() |
hetero INADL_HUMAN | QRTVNAGLDEFIKPSY |
DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
![]() | V | H | e | 25.3 | ![]() |
VYTEHRCAGLDFIKNPQS |
DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | H | H | e | 72.8 | ![]() |
HYFTK |
DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | M | H | e | 45.9 | ![]() |
hetero MPDZ_RAT | SMEYKC |
DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
![]() | N | S | e | 22.4 | ![]() |
NYERSD |
DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | K | e | 62.3 | ![]() |
precipitant | KEQGPRC |
DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | A | e | 74.1 | ![]() |
KASRQP |
DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |||
![]() | S | S | e | 64.8 | ![]() |
hetero MPDZ_RAT | SLQANEDFGIKPRTVY |
DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
![]() | P | e | 89.1 | ![]() |
PNSAGLDEIKQRTVCFHMY |
REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |||
![]() | P | e | 32.6 | ![]() |
precipitant | PADEFGIKLNQRSTV |
DOMAIN /note="L27 2" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED DOMAIN /note="L27 2" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | F | e | 71.3 | ![]() |
precipitant | VTFASYLM |
DOMAIN /note="L27 2" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED DOMAIN /note="L27 2" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | P | e | 21.7 | ![]() |
PED |
DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |||
![]() | L | S | e | 51.7 | ![]() |
AVLID |
DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | I | e | 27.5 | ![]() |
LTVI |
DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |||
![]() | S | S | e | 71.1 | ![]() |
HQDSGPT |
DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | N | e | 37.6 | ![]() |
HSRGN |
DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |||
![]() | A | H | b | 0.0 | ![]() |
AC |
DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | Q | H | e | 33.7 | ![]() |
QARKMGVT |
DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | D | H | e | 61.7 | ![]() |
ADEITVS |
DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | L | H | b | 4.5 | ![]() |
LV |
DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | A | H | b | 3.6 | ![]() |
ALST |
DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | Q | H | e | 47.4 | ![]() |
EQDCYA |
DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | E | H | e | 37.2 | ![]() |
EDQ |
DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | V | H | b | 0.0 | ![]() |
VLI |
DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | Q | H | b | 5.1 | ![]() |
QSAMELVT |
DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | T | H | e | 42.9 | ![]() |
ETCSVDN |
DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | V | H | e | 23.3 | ![]() |
ETLVIYMK |
DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | L | H | b | 1.7 | ![]() |
LPV |
DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | K | T | e | 71.7 | ![]() |
KQREGP |
DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | P | T | e | 82.9 | ![]() |
APDGENSIKLRTV |
DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | V | b | 13.3 | ![]() |
SLAKVTPDEGINR |
DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |||
![]() | H | e | 86.4 | ![]() |
precipitant | SAEHNYGTDIKLPRV |
DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | H | S | e | 46.6 | ![]() |
HSNGADEIKLPRTV |
DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | K | S | e | 71.7 | ![]() |
precipitant | SKPNEV |
DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
![]() | E | H | b | 12.1 | ![]() |
EDGA |
DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | G | H | b | 2.4 | ![]() |
IGEALSV |
DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | Q | H | e | 53.1 | ![]() |
precipitant | QRGKLASV |
DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
![]() | E | H | e | 29.1 | ![]() |
precipitant | EG |
DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
![]() | L | H | b | 0.0 | ![]() |
LM |
DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | T | H | e | 24.0 | ![]() |
LRATVKMS |
DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | A | H | e | 41.1 | ![]() |
QKRATGSH |
DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | L | H | b | 9.0 | ![]() |
LIAMV |
DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | L | H | b | 1.1 | ![]() |
L |
DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | N | H | e | 52.7 | ![]() |
SQNAKT |
DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | T | S | e | 20.1 | ![]() |
TKAEDQ |
DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | P | H | e | 48.1 | ![]() |
PLS |
DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | H | H | b | 12.0 | ![]() |
precipitant | HNY |
DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
![]() | I | H | b | 1.2 | ![]() |
FLVMIC |
DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | Q | H | e | 36.2 | ![]() |
QKREM |
DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | A | H | b | 7.1 | ![]() |
ASH |
DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | L | H | b | 0.6 | ![]() |
LV |
DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | L | H | b | 1.1 | ![]() |
LM |
DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | L | H | e | 29.8 | ![]() |
SEMQLH |
DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | A | H | b | 0.0 | ![]() |
AVTKS |
DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | H | H | b | 1.0 | ![]() |
H |
DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | D | H | b | 9.3 | ![]() |
DN |
DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | K | H | e | 29.2 | ![]() |
TSVKRI |
DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | V | H | e | 25.3 | ![]() |
VPI |
DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | A | H | b | 11.6 | ![]() |
AE |
DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | E | S | e | 52.3 | ![]() |
QESPDK |
DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | Q | S | e | 66.8 | ![]() |
KQEV |
DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | E | S | e | 89.9 | ![]() |
SNEADTC |
DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | M | S | e | 58.0 | ![]() |
YFMLP |
DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | Q | - | - | - | - | DEQR |
DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | L | - | - | - | - | LVTS |
DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | E | - | - | - | - | PETLS |
DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | P | S | e | 94.6 | ![]() |
PA |
REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | I | e | 64.3 | ![]() |
LPVMIS |
REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |||
![]() | T | S | e | 90.3 | ![]() |
PSLMTNV |
REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | D | e | 72.2 | ![]() |
DPEGY |
REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |||
![]() | E | e | 64.3 | ![]() |
DEGLSNA |
REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |||
![]() | R | e | 77.1 | ![]() |
NAIMLRSDEGKPTV |
REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |||
![]() | V | e | 110.0 | ![]() |
IDVGYNPAL |
REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |||
![]() | Y | S | e | 71.7 | ![]() |
YDPTEISNAL |
REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | E | e | 66.8 | ![]() |
ETDNSPAGLVFHIKMQRY |
REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |||
![]() | S | E | e | 71.9 | ![]() |
SEFGLANTDIKPQRVY |
REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | I | E | e | 44.4 | ![]() |
ILSPDNFAEGKTVQRCHMWY |
REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | G | e | 64.3 | ![]() |
NGDATLEKSVFIPQRCHMWY |
REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |||
![]() | Q | e | 54.1 | ![]() |
QEAVDGLSIKNPRTCFHMY |
REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |||
![]() | Y | S | e | 110.0 | ![]() |
ILVYEFMWAGSDKNPQRTCH |
REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | G | S | e | 91.7 | ![]() |
GPAEMDLSVFIKNQRTCHWY |
REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | G | S | e | 66.7 | ![]() |
metal CL | GEPAVMDFIKLNQRST |
REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
![]() | E | e | 61.8 | ![]() |
metal CL | EDKPR |
REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | T | e | 58.4 | ![]() |
SATNDPKL |
REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |||
![]() | V | E | b | 6.0 | ![]() |
VHMTRIL |
REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | K | E | e | 20.3 | ![]() |
metal CL | RK |
REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
![]() | I | E | b | 7.0 | ![]() |
LIVRM |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | V | E | b | 6.7 | ![]() |
VIL |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | R | E | e | 49.8 | ![]() |
RQFGLKCAS |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | I | E | b | 2.9 | ![]() |
IFLHSV |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | E | E | e | 58.8 | ![]() |
KVERHQYCLP |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | K | E | b | 7.1 | ![]() |
hetero CRUM1_HUMAN CRB_DROME VEMP_SARS2 precipitant | KGR |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
![]() | A | B | e | 48.2 | ![]() |
metal CL homo | GSNAVTDK |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
![]() | R | T | e | 64.0 | ![]() |
compound PUN metal CL homo | TQKRLDASY |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
![]() | D | T | e | 75.3 | ![]() |
metal NA | EDGSQTAKLV |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
![]() | I | B | e | 54.4 | ![]() |
homo | LEIVKRFADGNPQST |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
![]() | P | e | 63.6 | ![]() |
hetero VEMP_SARS2 CRB_DROME VEMP_SARS CRUM1_HUMAN homo precipitant | PGATDEHS |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | L | b | 8.4 | ![]() |
hetero VEMP_SARS2 CRB_DROME VEMP_SARS CRUM1_HUMAN precipitant | LIMF |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | G | S | b | 6.0 | ![]() |
hetero VEMP_SARS2 CRB_DROME VEMP_SARS CRUM1_HUMAN homo precipitant | GREN |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
![]() | A | E | e | 30.4 | ![]() |
hetero VEMP_SARS2 CRB_DROME VEMP_SARS CRUM1_HUMAN precipitant | AIVLGFS |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
![]() | T | E | b | 11.0 | ![]() |
hetero VEMP_SARS2 CRB_DROME VEMP_SARS CRUM1_HUMAN | TALYSGV |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
![]() | V | E | e | 29.3 | ![]() |
hetero VEMP_SARS2 CRB_DROME VEMP_SARS CRUM1_HUMAN | IGLVCFAP |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
![]() | R | E | e | 31.6 | ![]() |
hetero VEMP_SARS2 CRB_DROME VEMP_SARS CRUM1_HUMAN | GRKSDYAEILPTV |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
![]() | N | E | e | 29.1 | ![]() |
hetero CRB_DROME VEMP_SARS2 | NGDEKRSVHMAILPT |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
![]() | E | E | e | 20.6 | ![]() |
hetero CRB_DROME VEMP_SARS2 | DETNKPQAGILRSV |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
![]() | M | T | e | 50.7 | ![]() |
VGLFMIKTEDNAPRS |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | D | T | e | 42.0 | ![]() |
GDHEQPTSNALVFIKMRY |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | S | E | b | 3.1 | ![]() |
GPSAEKRDHL |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | V | E | b | 0.0 | ![]() |
IVCL |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | I | E | b | 8.2 | ![]() |
FYVILTMS |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | I | E | b | 2.3 | ![]() |
VI |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | S | E | e | 22.7 | ![]() |
hetero VEMP_SARS2 CRB_DROME VEMP_SARS | ASKG |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
![]() | R | E | b | 10.7 | ![]() |
hetero CRB_DROME CRUM1_HUMAN VEMP_SARS2 precipitant | RGFEKNAS |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
![]() | I | E | b | 14.0 | ![]() |
IVLM |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | V | b | 1.3 | ![]() |
hetero VEMP_SARS2 VEMP_SARS homo | LVMQEITYAF |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | K | T | e | 23.1 | ![]() |
homo precipitant | PEHADKR |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
![]() | G | T | e | 23.8 | ![]() |
GDR |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | G | S | b | 6.0 | ![]() |
homo | GST |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
![]() | A | H | e | 37.5 | ![]() |
PLAMSVI |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | A | H | b | 0.0 | ![]() |
AIV |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | E | H | e | 28.6 | ![]() |
EDHKAIQ |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | K | H | e | 72.2 | ![]() |
homo | RQGLSK |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
![]() | S | H | e | 35.2 | ![]() |
STQEPHDCAGN |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | G | T | e | 47.6 | ![]() |
GDAS |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | L | e | 32.0 | ![]() |
LGEAKTISRN |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |||
![]() | L | b | 2.2 | ![]() |
LIVADEFGKNPQRST |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |||
![]() | H | e | 46.6 | ![]() |
precipitant | HKQVARMEYG |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | E | T | e | 28.6 | ![]() |
homo | VEPRAKIT |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
![]() | G | T | b | 17.9 | ![]() |
homo | GNS |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
![]() | D | b | 0.0 | ![]() |
DM |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |||
![]() | E | E | b | 13.6 | ![]() |
EQRLIKV |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | V | E | b | 2.0 | ![]() |
ILV |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | L | E | b | 11.2 | ![]() |
LRIVKMA |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | E | E | e | 35.2 | ![]() |
ESAKQR |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | I | E | b | 1.2 | ![]() |
VIYW |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | N | T | e | 43.0 | ![]() |
NG |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | G | T | e | 81.0 | ![]() |
GSNTD |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | I | E | e | 29.8 | ![]() |
VIQLCMTHKS |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | E | E | e | 55.3 | ![]() |
precipitant | DSPENAVT |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
![]() | I | b | 0.0 | ![]() |
VLFMI |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |||
![]() | R | T | e | 36.0 | ![]() |
precipitant | RTAEKLQSD |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
![]() | G | T | e | 63.1 | ![]() |
GNSHDEA |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | K | e | 29.2 | ![]() |
KALRQVHIESN |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |||
![]() | D | e | 38.9 | ![]() |
TSRDPIHKNQ |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |||
![]() | V | H | e | 20.7 | ![]() |
hetero VEMP_SARS2 VEMP_SARS CRUM1_HUMAN CRB_DROME | HVPLREYQ |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
![]() | N | H | e | 62.4 | ![]() |
hetero VEMP_SARS2 CRB_DROME VEMP_SARS CRUM1_HUMAN | EDSKNRG |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
![]() | E | H | e | 47.2 | ![]() |
EQADKHS |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | V | H | b | 6.0 | ![]() |
hetero CRB_DROME VEMP_SARS2 | VALI |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
![]() | F | H | e | 56.9 | ![]() |
hetero VEMP_SARS2 CRB_DROME VEMP_SARS CRUM1_HUMAN metal CL precipitant | VQIATYLFS |
MUTAGEN /note="F->A,C: Increases interaction with CRB1." DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" MUTAGEN /note="F->A,C: Increases interaction with CRB1." DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
![]() | D | H | e | 58.6 | ![]() |
EQDHSAKVYLNRI |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | L | H | e | 26.4 | ![]() |
LIMAFE |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | L | H | b | 17.4 | ![]() |
hetero VEMP_SARS2 VEMP_SARS CRUM1_HUMAN CRB_DROME precipitant | LMI |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
![]() | S | H | e | 34.4 | ![]() |
metal NA precipitant | KALRSQTEIV |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
![]() | D | T | e | 81.5 | ![]() |
metal NA | AQENDKMGIPVRST |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
![]() | M | b | 11.6 | ![]() |
ASPNLMTQRI |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |||
![]() | H | e | 47.1 | ![]() |
compound PUN | GSKQPRDHCEAN |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | G | E | e | 27.4 | ![]() |
GQEHPDNKR |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | T | E | e | 42.2 | ![]() |
TSGNVAEMKQY |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | L | E | b | 0.0 | ![]() |
VLIEMT |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | T | E | e | 24.7 | ![]() |
TISEKVRMD |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | F | E | b | 2.9 | ![]() |
LFVITM |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | V | E | b | 16.7 | ![]() |
KVTILQARE |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | L | E | b | 0.0 | ![]() |
IVLYATG |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | I | E | b | 18.1 | ![]() |
ILRAVKQFPMDEGST |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | P | e | 39.5 | ![]() |
PQRYASTNDEFGIKLV |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |||
![]() | S | e | 24.2 | ![]() |
SAGQRKVENIDLPT |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |||
![]() | Q | e | 37.8 | ![]() |
SQEGYITADHRKNP |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |||
![]() | Q | e | 41.8 | ![]() |
QEKRSDFLP |
REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |||
![]() | I | e | 44.4 | ![]() |
VILSTYDEKGPANFQR |
REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |||
![]() | K | e | 33.5 | ![]() |
KERDAQISTFGP |
REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |||
![]() | P | e | 82.2 | ![]() |
PLERAHGKSDWIQ |
REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |||
![]() | P | S | e | 90.7 | ![]() |
PKADELGQSRTVYI |
REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | P | e | 103.9 | ![]() |
PTAVCRGLMEKQ |
REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |||
![]() | A | e | 79.5 | ![]() |
SRLGNACTYFQVI |
REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |||
![]() | K | e | 42.9 | ![]() |
KRQSEADPFHLN |
REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |||
![]() | E | e | 70.9 | ![]() |
ESGKQRANDVWILPT |
DOMAIN /note="SH3" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED DOMAIN /note="SH3" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |||
![]() | T | e | 62.3 | ![]() |
RGSDTAEIQKPLFNVY |
DOMAIN /note="SH3" DISORDER predicted by DISOPRED DOMAIN /note="SH3" | |||
![]() | V | e | 36.7 | ![]() |
SKVMDQPTLAEFGINRY |
DOMAIN /note="SH3" DISORDER predicted by DISOPRED DOMAIN /note="SH3" | |||
![]() | I | E | e | 39.8 | ![]() |
homo | FVILMS |
DOMAIN /note="SH3" DISORDER predicted by DISOPRED DOMAIN /note="SH3" | |
![]() | H | E | e | 66.5 | ![]() |
homo | YFSHR |
DOMAIN /note="SH3" DISORDER predicted by DISOPRED DOMAIN /note="SH3" | |
![]() | V | E | e | 32.0 | ![]() |
homo | VIME |
DOMAIN /note="SH3" DISORDER predicted by DISOPRED DOMAIN /note="SH3" | |
![]() | K | E | e | 58.0 | ![]() |
homo | RKTQ |
DOMAIN /note="SH3" DISORDER predicted by DISOPRED DOMAIN /note="SH3" | |
![]() | A | b | 4.5 | ![]() |
homo | ASTCG |
DOMAIN /note="SH3" DISORDER predicted by DISOPRED DOMAIN /note="SH3" | ||
![]() | H | e | 73.3 | ![]() |
homo | LHDQM |
DOMAIN /note="SH3" DISORDER predicted by DISOPRED DOMAIN /note="SH3" | ||
![]() | F | S | e | 32.5 | ![]() |
homo | FAYIT |
DOMAIN /note="SH3" DISORDER predicted by DISOPRED DOMAIN /note="SH3" | |
![]() | D | e | 61.7 | ![]() |
DEH |
DOMAIN /note="SH3" DISORDER predicted by DISOPRED DOMAIN /note="SH3" | |||
![]() | Y | B | b | 11.3 | ![]() |
YERFLC |
DOMAIN /note="SH3" DISORDER predicted by DISOPRED DOMAIN /note="SH3" | ||
![]() | D | e | 44.4 | ![]() |
DENWLQY |
DOMAIN /note="SH3" DISORDER predicted by DISOPRED DOMAIN /note="SH3" | |||
![]() | P | G | b | 11.6 | ![]() |
PAKRDEGILNQSTV |
DOMAIN /note="SH3" DOMAIN /note="SH3" | ||
![]() | S | G | e | 51.6 | ![]() |
ASKQTRENFL |
DOMAIN /note="SH3" DISORDER predicted by DISOPRED DOMAIN /note="SH3" | ||
![]() | D | G | e | 58.6 | ![]() |
EDKRPVMANQGILST |
DOMAIN /note="SH3" DOMAIN /note="SH3" | ||
![]() | D | b | 8.0 | ![]() |
DPTESNAGIKLQRV |
DOMAIN /note="SH3" DISORDER predicted by DISOPRED DOMAIN /note="SH3" | |||
![]() | P | S | e | 30.2 | ![]() |
PSGDKNREAFILQTV |
DOMAIN /note="SH3" DOMAIN /note="SH3" | ||
![]() | Y | e | 38.7 | ![]() |
LGAYDEQVCSFIKNPRT |
DOMAIN /note="SH3" DISORDER predicted by DISOPRED DOMAIN /note="SH3" | |||
![]() | V | b | 5.3 | ![]() |
ILAVFDEGKNPRSTCHMQY |
DOMAIN /note="SH3" DISORDER predicted by DISOPRED DOMAIN /note="SH3" | |||
![]() | P | S | e | 51.2 | ![]() |
hetero CRB_DROME VEMP_SARS2 | PALDEGIKRSTVCFHMNQY |
DOMAIN /note="SH3" DISORDER predicted by DISOPRED DOMAIN /note="SH3" | |
![]() | C | b | 10.7 | ![]() |
hetero CRB_DROME | CSDHLAEGKPTVFIMNQRY |
DOMAIN /note="SH3" DISORDER predicted by DISOPRED DOMAIN /note="SH3" | ||
![]() | R | G | e | 40.7 | ![]() |
KQRMVAGPLDEISTCFHNY |
DOMAIN /note="SH3" DISORDER predicted by DISOPRED DOMAIN /note="SH3" | ||
![]() | E | G | e | 68.3 | ![]() |
hetero CRB_DROME | EDQSFAGLIKNPRTVCHMY |
DOMAIN /note="SH3" DISORDER predicted by DISOPRED DOMAIN /note="SH3" | |
![]() | L | G | b | 14.6 | ![]() |
hetero CRB_DROME VEMP_SARS2 | ALPQMGSDEIKNRTVCFHY |
DOMAIN /note="SH3" DOMAIN /note="SH3" | |
![]() | G | B | e | 27.4 | ![]() |
GAES |
DOMAIN /note="SH3" DISORDER predicted by DISOPRED DOMAIN /note="SH3" | ||
![]() | L | b | 7.9 | ![]() |
LIVAEGKST |
DOMAIN /note="SH3" DOMAIN /note="SH3" | |||
![]() | S | e | 41.4 | ![]() |
SPGKAQRNCELTV |
DOMAIN /note="SH3" DOMAIN /note="SH3" | |||
![]() | F | B | b | 3.3 | ![]() |
F |
DOMAIN /note="SH3" DOMAIN /note="SH3" | ||
![]() | Q | e | 68.4 | ![]() |
KQRNTSLA |
DOMAIN /note="SH3" DOMAIN /note="SH3" | |||
![]() | K | T | e | 67.5 | ![]() |
KRFYTVAHQ |
DOMAIN /note="SH3" DOMAIN /note="SH3" | ||
![]() | G | T | e | 36.9 | ![]() |
GDR |
DOMAIN /note="SH3" DOMAIN /note="SH3" | ||
![]() | D | e | 29.6 | ![]() |
DEQ |
DOMAIN /note="SH3" DOMAIN /note="SH3" | |||
![]() | I | E | e | 35.1 | ![]() |
IVFL |
DOMAIN /note="SH3" DOMAIN /note="SH3" | ||
![]() | L | E | b | 3.9 | ![]() |
LIF |
DOMAIN /note="SH3" DOMAIN /note="SH3" | ||
![]() | H | E | b | 16.8 | ![]() |
HQRYAE |
DOMAIN /note="SH3" DOMAIN /note="SH3" | ||
![]() | V | E | b | 2.0 | ![]() |
VI |
DOMAIN /note="SH3" DOMAIN /note="SH3" | ||
![]() | I | E | b | 14.0 | ![]() |
IVLMFT |
DOMAIN /note="SH3" DOMAIN /note="SH3" | ||
![]() | S | E | b | 8.6 | ![]() |
DNSPE |
DOMAIN /note="SH3" DOMAIN /note="SH3" | ||
![]() | Q | e | 42.3 | ![]() |
QAKNSTDCR |
DOMAIN /note="SH3" DOMAIN /note="SH3" | |||
![]() | E | S | e | 57.8 | ![]() |
SDGLEVNQ |
DOMAIN /note="SH3" DOMAIN /note="SH3" | ||
![]() | D | S | e | 28.4 | ![]() |
DKYTVCH |
MUTAGEN /note="D->K: Reduces binding to Drosophila crb and causes incorrect PALS1 localization and cell polarity." DOMAIN /note="SH3" MUTAGEN /note="D->K: Reduces binding to Drosophila crb and causes incorrect PALS1 localization and cell polarity." DOMAIN /note="SH3" | ||
![]() | P | T | e | 43.4 | ![]() |
PDAFLEHKSV |
DOMAIN /note="SH3" DOMAIN /note="SH3" | ||
![]() | N | T | e | 23.0 | ![]() |
GNETLDH |
DOMAIN /note="SH3" DOMAIN /note="SH3" | ||
![]() | W | E | b | 7.2 | ![]() |
WSHL |
DOMAIN /note="SH3" DOMAIN /note="SH3" | ||
![]() | W | E | b | 15.5 | ![]() |
homo | W |
DOMAIN /note="SH3" DOMAIN /note="SH3" | |
![]() | Q | E | b | 3.6 | ![]() |
QLKMT |
DOMAIN /note="SH3" DOMAIN /note="SH3" | ||
![]() | A | E | b | 0.0 | ![]() |
AG |
DOMAIN /note="SH3" DOMAIN /note="SH3" | ||
![]() | Y | E | b | 18.7 | ![]() |
RKVWAISGYH |
DOMAIN /note="SH3" DOMAIN /note="SH3" | ||
![]() | R | E | e | 20.2 | ![]() |
RKLVHCQSADEGT |
DOMAIN /note="SH3" DOMAIN /note="SH3" | ||
![]() | E | T | e | 62.8 | ![]() |
VEIQMHRDL |
DOMAIN /note="SH3" DOMAIN /note="SH3" | ||
![]() | G | T | e | 71.4 | ![]() |
GTLHANSM |
DOMAIN /note="SH3" DOMAIN /note="SH3" | ||
![]() | D | e | 22.8 | ![]() |
DNPSRGKQEALIV |
DOMAIN /note="SH3" DOMAIN /note="SH3" | |||
![]() | E | e | 96.0 | ![]() |
EDNSTAHGLPKQ |
DOMAIN /note="SH3" DOMAIN /note="SH3" | |||
![]() | D | S | e | 59.9 | ![]() |
GNLDAHSTEKIPQRV |
DOMAIN /note="SH3" DOMAIN /note="SH3" | ||
![]() | N | e | 55.2 | ![]() |
EANLRDIKMSTGFPQV |
DOMAIN /note="SH3" DOMAIN /note="SH3" | |||
![]() | Q | e | 47.4 | ![]() |
EQSRFKLTAVGNDHIMPY |
DOMAIN /note="SH3" DOMAIN /note="SH3" | |||
![]() | P | e | 58.9 | ![]() |
EPKQVDTIAGLNRSCFHMY |
DOMAIN /note="SH3" DOMAIN /note="SH3" | |||
![]() | L | S | e | 21.3 | ![]() |
hetero CRB_DROME | EIRCLADQSVFGKTHMNPY |
DOMAIN /note="SH3" DOMAIN /note="SH3" | |
![]() | A | b | 4.5 | ![]() |
ARQTIMNEVGL |
DOMAIN /note="SH3" DOMAIN /note="SH3" | |||
![]() | G | E | b | 10.7 | ![]() |
GY |
DOMAIN /note="SH3" DOMAIN /note="SH3" | ||
![]() | L | E | b | 0.6 | ![]() |
LVIQYF |
DOMAIN /note="SH3" DOMAIN /note="SH3" | ||
![]() | V | E | b | 1.3 | ![]() |
homo | IVFT |
DOMAIN /note="SH3" DOMAIN /note="SH3" | |
![]() | P | E | b | 17.1 | ![]() |
homo | P |
DOMAIN /note="SH3" DOMAIN /note="SH3" | |
![]() | G | b | 10.7 | ![]() |
SNLG |
DOMAIN /note="SH3" DOMAIN /note="SH3" | |||
![]() | K | e | 47.6 | ![]() |
homo | KQNP |
DOMAIN /note="SH3" DOMAIN /note="SH3" | ||
![]() | S | - | - | - | - | SRYEHKNQLFG |
DOMAIN /note="SH3" DOMAIN /note="SH3" | ||
![]() | F | - | - | - | - | RLFVW |
DOMAIN /note="SH3" DOMAIN /note="SH3" | ||
![]() | Q | - | - | - | - | QVAEMRK |
DOMAIN /note="SH3" DOMAIN /note="SH3" | ||
![]() | Q | - | - | - | - | EKDQR |
DOMAIN /note="SH3" DISORDER predicted by DISOPRED DOMAIN /note="SH3" | ||
![]() | Q | - | - | - | - | QRKWLE |
DOMAIN /note="SH3" DISORDER predicted by DISOPRED DOMAIN /note="SH3" | ||
![]() | R | - | - | - | - | RKLEMQ |
DOMAIN /note="SH3" DISORDER predicted by DISOPRED DOMAIN /note="SH3" | ||
![]() | E | - | - | - | - | EAFLVDKRIT |
DOMAIN /note="SH3" DISORDER predicted by DISOPRED DOMAIN /note="SH3" | ||
![]() | A | - | - | - | - | ASPRFWL |
DISORDER predicted by DISOPRED | ||
![]() | M | - | - | - | - | LRVSCFTYMWAG |
DISORDER predicted by DISOPRED | ||
![]() | K | - | - | - | - | RQKLEVDGITAMWFNPSY |
DISORDER predicted by DISOPRED | ||
![]() | Q | - | - | - | - | RLKQAESYNGTDFIPV |
DISORDER predicted by DISOPRED | ||
![]() | T | - | - | - | - | TASEKPRNVHMQDFGIL |
DISORDER predicted by DISOPRED | ||
![]() | I | - | - | - | - | VLMQAIGSTWDKE |
DISORDER predicted by DISOPRED | ||
![]() | E | - | - | - | - | EKSRGPQALDWFTV |
DISORDER predicted by DISOPRED | ||
![]() | E | - | - | - | - | ERKATFSQNPDIGLV |
DISORDER predicted by DISOPRED | ||
![]() | D | - | - | - | - | NTSDVLAGPIREFKQ |
DISORDER predicted by DISOPRED | ||
![]() | K | - | - | - | - | KASNPREGLYVDIT |
DISORDER predicted by DISOPRED | ||
![]() | E | - | - | - | - | GEQSDAKNRFILPTV |
DISORDER predicted by DISOPRED | ||
![]() | P | - | - | - | - | PGDSALETFHKRINQV |
DISORDER predicted by DISOPRED | ||
![]() | E | - | - | - | - | QGDNSEHLRTACPFIKVY |
DISORDER predicted by DISOPRED | ||
![]() | K | - | - | - | - | RTKADFPSVGNQLEIY |
DISORDER predicted by DISOPRED | ||
![]() | S | - | - | - | - | SARTEKNQLDFGIPVY |
DISORDER predicted by DISOPRED | ||
![]() | G | - | - | - | - | GASFKTQRCHLDEINPVY |
DISORDER predicted by DISOPRED | ||
![]() | K | - | - | - | - | EKDRSTLGQCVFMAINPY |
DISORDER predicted by DISOPRED | ||
![]() | L | - | - | - | - | LFTSIRVDMQAEGKNPY |
DISORDER predicted by DISOPRED | ||
![]() | W | - | - | - | - | WFSLDGREKYAINPQTV |
DISORDER predicted by DISOPRED | ||
![]() | C | - | - | - | - | CSGARFLNPTY |
DISORDER predicted by DISOPRED | ||
![]() | A | - | - | - | - | SAGRLQVDKNFM |
DISORDER predicted by DISOPRED | ||
![]() | K | - | - | - | - | KRSAPIELTDGV |
DISORDER predicted by DISOPRED | ||
![]() | K | - | - | - | - | KRFSLIDM |
DISORDER predicted by DISOPRED | ||
![]() | N | - | - | - | - | NSGTKRDFLP |
DISORDER predicted by DISOPRED | ||
![]() | K | - | - | - | - | KLRSGFVTNDEP |
DISORDER predicted by DISOPRED | ||
![]() | K | - | - | - | - | KRQSEFGHVDNTY |
DISORDER predicted by DISOPRED | ||
![]() | K | - | - | - | - | KGRFQYSCDEILT |
DISORDER predicted by DISOPRED | ||
![]() | R | - | - | - | - | RSKETLHNDV |
DISORDER predicted by DISOPRED | ||
![]() | K | - | - | - | - | KRLETDYNPACIV |
DISORDER predicted by DISOPRED | ||
![]() | K | - | - | - | - | KERAFDSGHNP |
DISORDER predicted by DISOPRED | ||
![]() | V | - | - | - | - | DVSMLFGYAHRPNEIKQT |
DISORDER predicted by DISOPRED | ||
![]() | L | - | - | - | - | LMKFPSGTIQADERV |
DISORDER predicted by DISOPRED | ||
![]() | Y | - | - | - | - | YSFTAHNQVIDEGKLPR |
DISORDER predicted by DISOPRED | ||
![]() | N | - | - | - | - | ALETDKNGIMQFYPRSV |
DISORDER predicted by DISOPRED | ||
![]() | A | - | - | - | - | ACLQRGSTDKV |
DISORDER predicted by DISOPRED | ||
![]() | N | - | - | - | - | KGSTNPVDAERL |
DISORDER predicted by DISOPRED | ||
![]() | K | - | - | - | - | KGHRSVEFADMNL |
DISORDER predicted by DISOPRED | ||
![]() | N | - | - | - | - | SNQDEGRVFPL |
DISORDER predicted by DISOPRED | ||
![]() | D | - | - | - | - | DSAEGTQLPIKNRV |
DISORDER predicted by DISOPRED | ||
![]() | D | - | - | - | - | GQDIKSEALTHRVFNP |
DISORDER predicted by DISOPRED | ||
![]() | Y | - | - | - | - | FYGRHNASMDEIKLPQTV |
DISORDER predicted by DISOPRED | ||
![]() | D | - | - | - | - | DPSEQARVGKFILNT |
DISORDER predicted by DISOPRED | ||
![]() | N | - | - | - | - | NSTQAERPGDL |
DISORDER predicted by DISOPRED | ||
![]() | E | e | 29.1 | ![]() |
homo | ELDQYAHTKMP |
DISORDER predicted by DISOPRED | ||
![]() | E | e | 87.4 | ![]() |
homo | EDSKQRVTAY |
DISORDER predicted by DISOPRED | ||
![]() | I | e | 49.7 | ![]() |
homo | VILRMFAC |
DISORDER predicted by DISOPRED | ||
![]() | L | e | 61.2 | ![]() |
homo | LVPMQIRTWA |
DISORDER predicted by DISOPRED | ||
![]() | T | S | e | 90.3 | ![]() |
homo | TSVAILCG |
DISORDER predicted by DISOPRED | |
![]() | Y | S | e | 88.7 | ![]() |
homo | YFLIQ |
DISORDER predicted by DISOPRED | |
![]() | E | e | 48.2 | ![]() |
homo | ERFQL |
DISORDER predicted by DISOPRED | ||
![]() | E | e | 61.8 | ![]() |
homo | EDPRKNTAGLSV |
DISORDER predicted by DISOPRED | ||
![]() | M | E | e | 33.8 | ![]() |
homo | VMATNSCLDEGIKPR |
DISORDER predicted by DISOPRED | |
![]() | S | E | b | 18.0 | ![]() |
SATVEGLNMIP |
|||
![]() | L | E | e | 39.9 | ![]() |
LVFRKPTMADEGINQS |
|||
![]() | Y | E | b | 19.1 | ![]() |
YLSVAEITWGDFHKMNPQR |
|||
![]() | H | e | 64.9 | ![]() |
HRQSYAKNGLDEFIPTV |
||||
![]() | Q | b | 10.2 | ![]() |
QRMESLKHDGIATV |
||||
![]() | P | e | 36.4 | ![]() |
PETKRIVQADMSGLN |
||||
![]() | A | T | e | 75.0 | ![]() |
ASVGPTDILQREHNK |
|||
![]() | N | T | e | 58.8 | ![]() |
NDFGHSEIQRATCPVYKL |
|||
![]() | R | S | e | 36.4 | ![]() |
RKYFQSAELPDGNV |
|||
![]() | K | b | 13.7 | ![]() |
GKRPASVTEHQY |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |||
![]() | R | b | 1.6 | ![]() |
RKLNQGMSTV |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |||
![]() | P | b | 0.0 | ![]() |
LPTGIMVN |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |||
![]() | I | E | b | 0.0 | ![]() |
VILFTYM |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
![]() | I | E | b | 0.0 | ![]() |
VILTEMAF |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
![]() | L | E | b | 0.0 | ![]() |
LIVFM |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
![]() | I | E | b | 1.8 | ![]() |
SILFVTACM |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
![]() | G | S | e | 21.4 | ![]() |
GAS |
BINDING /ligand="ATP" /ligand_id="ChEBI:CHEBI:30616" DOMAIN /note="Guanylate kinase-like" BINDING /ligand="ATP" /ligand_id="ChEBI:CHEBI:30616" DOMAIN /note="Guanylate kinase-like" | ||
![]() | P | b | 1.6 | ![]() |
PAS |
BINDING /ligand="ATP" /ligand_id="ChEBI:CHEBI:30616" DOMAIN /note="Guanylate kinase-like" BINDING /ligand="ATP" /ligand_id="ChEBI:CHEBI:30616" DOMAIN /note="Guanylate kinase-like" | |||
![]() | Q | T | e | 60.7 | ![]() |
hetero CRB_DROME | SILVATMQEHP |
BINDING /ligand="ATP" /ligand_id="ChEBI:CHEBI:30616" DOMAIN /note="Guanylate kinase-like" BINDING /ligand="ATP" /ligand_id="ChEBI:CHEBI:30616" DOMAIN /note="Guanylate kinase-like" | |
![]() | N | T | e | 60.0 | ![]() |
GAKNELSVDFHIMPQRTY |
BINDING /ligand="ATP" /ligand_id="ChEBI:CHEBI:30616" DOMAIN /note="Guanylate kinase-like" BINDING /ligand="ATP" /ligand_id="ChEBI:CHEBI:30616" DOMAIN /note="Guanylate kinase-like" | ||
![]() | C | T | b | 4.0 | ![]() |
VATCSDGELFHIKMNPQRY |
BINDING /ligand="ATP" /ligand_id="ChEBI:CHEBI:30616" DOMAIN /note="Guanylate kinase-like" BINDING /ligand="ATP" /ligand_id="ChEBI:CHEBI:30616" DOMAIN /note="Guanylate kinase-like" | ||
![]() | G | T | b | 10.7 | ![]() |
GRAEHLSVDFIKMNPQTY |
BINDING /ligand="ATP" /ligand_id="ChEBI:CHEBI:30616" DOMAIN /note="Guanylate kinase-like" BINDING /ligand="ATP" /ligand_id="ChEBI:CHEBI:30616" DOMAIN /note="Guanylate kinase-like" | ||
![]() | Q | H | b | 6.1 | ![]() |
KALRQV |
BINDING /ligand="ATP" /ligand_id="ChEBI:CHEBI:30616" DOMAIN /note="Guanylate kinase-like" BINDING /ligand="ATP" /ligand_id="ChEBI:CHEBI:30616" DOMAIN /note="Guanylate kinase-like" | ||
![]() | N | H | e | 50.3 | ![]() |
hetero CRB_DROME | SDTGNRHAKL |
BINDING /ligand="ATP" /ligand_id="ChEBI:CHEBI:30616" DOMAIN /note="Guanylate kinase-like" BINDING /ligand="ATP" /ligand_id="ChEBI:CHEBI:30616" DOMAIN /note="Guanylate kinase-like" | |
![]() | E | H | e | 51.8 | ![]() |
TSEVIAHRDL |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
![]() | L | H | b | 0.0 | ![]() |
LVIAFGS |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
![]() | R | H | e | 22.1 | ![]() |
hetero CRB_DROME | VRIKALMNCESTDGPQ |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |
![]() | Q | H | e | 46.9 | ![]() |
hetero CRB_DROME | KERQNSADHGVLT |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |
![]() | R | H | e | 29.2 | ![]() |
AKRMEDLQTGHVCFINSY |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
![]() | L | H | b | 0.0 | ![]() |
LIVKMACFTW |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
![]() | M | H | e | 21.3 | ![]() |
LAIVFTMRYCEPQS |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
![]() | N | H | e | 70.3 | ![]() |
ESNRADKTQGVILHM |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
![]() | K | H | e | 64.6 | ![]() |
EQKRDTSAINGLWCFHMPVY |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
![]() | E | T | e | 23.6 | ![]() |
EDFAKNHMPQRLVISTYCG |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
![]() | K | T | e | 27.4 | ![]() |
PKDSTELMNQAFGHRVCIY |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
![]() | D | T | e | 75.3 | ![]() |
DESLNTGPQAHFIRVY |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
![]() | R | T | e | 21.7 | ![]() |
KRIQLDENAGHSVPTYCM |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
![]() | F | E | b | 2.4 | ![]() |
FLYIVMQWHKNRS |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
![]() | A | E | b | 18.8 | ![]() |
QAGERTCVKSLFHYDIMNW |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
![]() | S | e | 50.8 | ![]() |
hetero CRB_DROME | ISYLFRTVQKADEGHMP |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
![]() | A | b | 8.0 | ![]() |
SACLTGPEIVDKR |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |||
![]() | V | b | 20.0 | ![]() |
VIPKALNTRCDEFGQSY |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |||
![]() | P | e | 20.9 | ![]() |
hetero CRB_DROME | SPLECTADFGIKNQRVY |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
![]() | H | E | b | 12.0 | ![]() |
HAEKYDVMFLTCSGINPQRW |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
![]() | T | E | b | 0.0 | ![]() |
TEPVLFCSADGIKNQR |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
![]() | T | b | 11.7 | ![]() |
TSRMIADEFGKLNPQVY |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |||
![]() | R | S | b | 9.5 | ![]() |
hetero CRB_DROME | RKDVMAEFGILNPQSTY |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |
![]() | S | e | 79.7 | ![]() |
APSKQEGTDFILNRVHY |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |||
![]() | R | e | 53.8 | ![]() |
PKRGMAQIVDEFLNST |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |||
![]() | R | e | 54.9 | ![]() |
hetero CRB_DROME | RTKSYADEFGILNPQV |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
![]() | D | T | e | 95.1 | ![]() |
DPESKGFALNQRVCHIT |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
![]() | Q | T | e | 93.9 | ![]() |
GPQYSEKADNHLMTFIRV |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
![]() | E | b | 16.6 | ![]() |
DEKRALFGINPQSTVY |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |||
![]() | V | e | 44.7 | ![]() |
VIQDREKSTAGMLNCHP |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |||
![]() | A | T | e | 51.8 | ![]() |
DENHAPSGIKLQRTV |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
![]() | G | T | e | 52.4 | ![]() |
GRADSEIKLNPTV |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
![]() | R | T | e | 63.2 | ![]() |
hetero CRB_DROME | VKREQISTLADFGHMNP |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |
![]() | D | T | e | 27.2 | ![]() |
hetero CRB_DROME | DHENSAGLFIKPQRTVY |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |
![]() | Y | e | 26.1 | ![]() |
hetero CRB_DROME | YHLADEFGIKNPQRSTV |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
![]() | H | E | e | 30.9 | ![]() |
HFYRNISAKLVDEGPQTW |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
![]() | F | E | e | 20.6 | ![]() |
FYLADEGIKNPQRSTV |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
![]() | V | e | 25.3 | ![]() |
VILKRTQMACDEFGHNPS |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |||
![]() | S | e | 58.6 | ![]() |
STDAEINPGKLQRV |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |||
![]() | R | H | e | 21.3 | ![]() |
RKVEQAPHDINTGLMS |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
![]() | Q | H | e | 50.0 | ![]() |
EDAQKSTGHLPRINV |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
![]() | A | H | e | 32.1 | ![]() |
EATQVRKDLSCGHIMNP |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
![]() | F | H | b | 0.0 | ![]() |
FMIELADGKNPQRSTVY |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
![]() | E | H | b | 6.5 | ![]() |
EKQRDLAIPTVHMCGNSW |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
![]() | A | H | e | 37.5 | ![]() |
AREKQTSDNGCHILMPVY |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
![]() | D | H | b | 17.3 | ![]() |
LMDGRKAEQSCINPTVW |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
![]() | I | H | e | 24.6 | ![]() |
IVLRAECGKTDFHMNPQS |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
![]() | A | H | e | 55.4 | ![]() |
ADEKSQGNRFHLTVY |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
![]() | A | T | e | 60.7 | ![]() |
ASENDQKPRGMHTCIL |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
![]() | G | T | e | 52.4 | ![]() |
GNDSECHKALQRV |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
![]() | K | e | 47.2 | ![]() |
EKDAGQLIRFNCHMSTVY |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |||
![]() | F | E | b | 4.8 | ![]() |
FLIMYACGSV |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
![]() | I | E | b | 1.8 | ![]() |
LIVRAFGMSY |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
![]() | E | E | e | 20.1 | ![]() |
hetero CRB_DROME | EKLDAGSV |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |
![]() | H | E | e | 39.3 | ![]() |
WYHSAFTVCDEGIKLNPQR |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
![]() | G | E | e | 38.1 | ![]() |
hetero CRB_DROME | AGKEVFTLNSDIPQRY |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |
![]() | E | E | e | 27.1 | ![]() |
EKQRSTLNFGHAMVYCDIP |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
![]() | F | E | e | 55.5 | ![]() |
hetero CRB_DROME | VYFILRHASDEGKNPQT |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |
![]() | E | T | e | 52.3 | ![]() |
FHEYASVGKQLNCDIPRT |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
![]() | K | T | e | 42.9 | ![]() |
GDNKESRTAILPQV |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
![]() | N | E | e | 25.5 | ![]() |
NHSDEGRAQTYIKLPV |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
![]() | L | E | b | 4.5 | ![]() |
YFLSRCMKWHINADEGPQTV |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
![]() | Y | E | b | 16.5 | ![]() |
hetero CRB_DROME | YGDKFSAEHILNPQRTV |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |
![]() | G | E | b | 6.0 | ![]() |
GVADEIKLNPRST |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
![]() | T | E | b | 14.3 | ![]() |
hetero CRB_DROME | TVLISADEGKNPR |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |
![]() | S | E | b | 4.7 | ![]() |
SPLRAKNTEGI |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
![]() | I | H | b | 14.0 | ![]() |
RKLVIAFQTEGHMY |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
![]() | D | H | e | 54.9 | ![]() |
DAEKSQNGPRTVHL |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
![]() | S | H | b | 4.7 | ![]() |
PTSAEQYWVFDGHIKNR |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
![]() | V | H | b | 0.0 | ![]() |
VILASTM |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
![]() | R | H | e | 30.0 | ![]() |
ERKQDLNHMAFISTV |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
![]() | Q | H | e | 68.4 | ![]() |
EQKADRGNTVPSFILMY |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
![]() | V | H | b | 10.7 | ![]() |
IAVQTLRKMNEFGHY |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
![]() | I | H | b | 11.1 | ![]() |
LIAMTHRVWEFQS |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
![]() | N | T | e | 52.7 | ![]() |
AEDKNSQRTGHILV |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
![]() | S | T | e | 57.0 | ![]() |
QKASERDTNLVHM |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
![]() | G | T | e | 34.5 | ![]() |
GDNEKSV |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
![]() | K | S | e | 30.7 | ![]() |
KRIQHLVEFNCDGMPSTY |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
![]() | I | E | b | 3.5 | ![]() |
DHINVPSATEKLRW |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
![]() | C | E | b | 0.0 | ![]() |
VACLIMSPT |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
![]() | L | E | b | 3.9 | ![]() |
LIVFCM |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
![]() | L | E | b | 9.0 | ![]() |
LFIVAMCD |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
![]() | S | E | e | 20.3 | ![]() |
hetero CRB_DROME | DEVHSCIKNR |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |
![]() | L | b | 4.5 | ![]() |
hetero CRB_DROME | IVLMDN |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
![]() | R | e | 44.3 | ![]() |
hetero CRB_DROME | DETANSQVHR |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
![]() | T | G | e | 35.7 | ![]() |
WPVLTIYGACFKM |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
![]() | Q | G | e | 37.2 | ![]() |
QENKHSADFGLRTVY |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
![]() | S | G | b | 7.0 | ![]() |
GADTSKQ |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
![]() | L | H | b | 3.9 | ![]() |
AVLIMFTGHR |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
![]() | K | H | e | 21.7 | ![]() |
RKQDELANHTFIM |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
![]() | T | H | e | 36.4 | ![]() |
QRSVLKANTHIEFG |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
![]() | L | H | b | 0.0 | ![]() |
LVIKAFMTY |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
![]() | R | H | b | 10.3 | ![]() |
RKNQHAGYDEILT |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
![]() | N | T | e | 69.1 | ![]() |
KYETANSQRDGHIVLM |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
![]() | S | S | b | 15.6 | ![]() |
KASTLVQIMRGNCFHPYDE |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
![]() | D | T | e | 61.1 | ![]() |
QMFEYDALGHIKNRSVPCT |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
![]() | L | T | b | 2.2 | ![]() |
PLFIWYADKSEMQRVGNT |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
![]() | K | b | 17.9 | ![]() |
DEYKNQGARSFPHVMT |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |||
![]() | P | b | 0.8 | ![]() |
PAGVDSKTCELNQW |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |||
![]() | Y | E | b | 2.2 | ![]() |
IVYLRKFHATCEMNQS |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
![]() | I | E | b | 0.6 | ![]() |
VSFTYLIAGQEMR |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
![]() | I | E | b | 0.0 | ![]() |
IVLF |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
![]() | F | E | b | 4.8 | ![]() |
FLYI |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
![]() | I | E | b | 0.0 | ![]() |
ILVFC |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
![]() | A | E | b | 6.2 | ![]() |
LAKNQRVISTHMCDE |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
![]() | P | b | 10.1 | ![]() |
PATYE |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |||
![]() | P | b | 9.3 | ![]() |
PDKEMTSAGR |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |||
![]() | S | e | 57.8 | ![]() |
SDNTCEAIKR |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |||
![]() | Q | H | e | 32.1 | ![]() |
LKIMRQFWAVENTY |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
![]() | E | H | e | 38.2 | ![]() |
EDQAKSTPGHLNRV |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
![]() | R | H | e | 56.5 | ![]() |
EADGVKRTHIMNSLPQ |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
![]() | L | H | b | 4.5 | ![]() |
LVIYMKRT |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
![]() | R | H | e | 23.3 | ![]() |
ERKQVLADHIMYFNST |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
![]() | A | H | e | 74.1 | ![]() |
REAKTQNGSDCHLFIV |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
![]() | L | H | e | 61.2 | ![]() |
RLMIYKPT |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
![]() | L | e | 72.5 | ![]() |
LIADRSVYEGKMNPQT |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |||
![]() | A | - | - | - | - | RIKTAEQSVCHLNDGYFMP |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
![]() | K | - | - | - | - | GKRNPESTALQDHCFIVY |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
![]() | E | - | - | - | - | REDAKLQSGHINPTV |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
![]() | G | - | - | - | - | GSANRDQTEIKLPW |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
![]() | K | - | - | - | - | TQRKLSEADPIMVY |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
![]() | N | - | - | - | - | DENTRSAGFKLQV |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
![]() | P | e | 116.3 | ![]() |
STPEADLQRFKNVGIMY |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |||
![]() | K | e | 28.3 | ![]() |
EDKTARQNSPLMFGHIV |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |||
![]() | P | H | e | 93.8 | ![]() |
EDASPTQNILVGKFHMRY |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
![]() | E | H | e | 34.2 | ![]() |
EVKADRSQTIFGHLMNP |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
![]() | E | e | 52.8 | ![]() |
hetero VEMP_SARS2 | IESVDQALHRTKGMN |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
![]() | L | H | e | 42.1 | ![]() |
LAISVEQTFRDKMGN |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
![]() | R | H | e | 30.8 | ![]() |
RKQAEINSVFHLDGMPT |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
![]() | E | H | e | 32.7 | ![]() |
REKDQAVGSCHILMNT |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
![]() | I | H | e | 23.4 | ![]() |
LRIMVTQADFS |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
![]() | I | H | e | 66.1 | ![]() |
LIAYVFREMQSDGKNT |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
![]() | E | H | e | 23.1 | ![]() |
EADKQNLMRSTCGHVY |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
![]() | K | H | b | 8.0 | ![]() |
ARKQELSTDGHV |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
![]() | T | H | e | 27.3 | ![]() |
ASRMTVNYGKQECHIL |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
![]() | R | H | e | 36.4 | ![]() |
ARKQESNDHGIMVLTWY |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
![]() | E | H | b | 10.6 | ![]() |
EKRADQFLMVGHIPSTY |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
![]() | M | H | e | 20.8 | ![]() |
ILMAVEFKYDNTCGHQRS |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
![]() | E | T | e | 63.8 | ![]() |
ERQKSADNILMVT |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
![]() | Q | T | e | 33.2 | ![]() |
QILKSAMRHEVDNCFGTY |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
![]() | N | G | e | 29.1 | ![]() |
EASNQHTGKLRDIMVYFW |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
![]() | N | G | e | 81.8 | ![]() |
YHAFNSDIECKLMVRGPQTW |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
![]() | G | G | e | 38.1 | ![]() |
AGSELNPQWHRCFIKMTVDY |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
![]() | H | e | 63.4 | ![]() |
homo | HDEGSRPNQAKLYFITV |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
![]() | Y | e | 26.1 | ![]() |
YLEKFQADRWHNCGIPSTV |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |||
![]() | F | S | b | 8.1 | ![]() |
FYACHIV |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
![]() | D | S | e | 32.1 | ![]() |
DTEKNGPQRS |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
![]() | T | E | e | 27.3 | ![]() |
YATFHLKVEGRIQ |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
![]() | A | E | e | 45.5 | ![]() |
VITLAEKQSCNRW |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
![]() | I | E | b | 4.1 | ![]() |
IVLF |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
![]() | V | E | e | 58.0 | ![]() |
VILTNQEFSY |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
![]() | N | b | 10.9 | ![]() |
NGAQREHK |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |||
![]() | S | S | e | 30.5 | ![]() |
DEGSNHAQRTK |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
![]() | D | S | e | 50.6 | ![]() |
DNETSAKVHMQRGL |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
![]() | L | H | e | 25.3 | ![]() |
LFVINSMPAY |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
![]() | D | H | e | 56.8 | ![]() |
DENSQATHKPGV |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
![]() | K | H | e | 29.7 | ![]() |
ETKRQDSVGNALHIP |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
![]() | A | H | b | 2.7 | ![]() |
ATSWICV |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
![]() | Y | H | b | 0.9 | ![]() |
YLVFACIKEHRS |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
![]() | Q | H | e | 54.6 | ![]() |
AEQSNKGDTRHMFLVY |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
![]() | E | H | e | 33.7 | ![]() |
EQDKARSHTVILN |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
![]() | L | H | b | 0.0 | ![]() |
LIVFMTAC |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
![]() | L | H | b | 6.2 | ![]() |
KLERVQISHACDMNTWY |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
![]() | R | H | e | 43.1 | ![]() |
SATEKQRDHLNCGV |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
![]() | L | H | b | 2.8 | ![]() |
ILVATMSFRY |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
![]() | I | H | b | 1.2 | ![]() |
IVLFMATY |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
![]() | N | H | e | 36.4 | ![]() |
EQSDNRHTKAGLW |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
![]() | K | T | e | 27.8 | ![]() |
KQRESDHAILNT |
|||
![]() | L | T | b | 1.1 | ![]() |
LQFAIEVNRYP |
|||
![]() | D | T | e | 42.6 | ![]() |
QRSDEKCLTPANH |
|||
![]() | T | T | e | 79.9 | ![]() |
TGNSLEAKMQRDHIP |
|||
![]() | E | S | e | 44.2 | ![]() |
EQTAKDPRSHIY |
|||
![]() | P | e | 30.2 | ![]() |
PKTALGYVFHRE |
||||
![]() | Q | E | b | 14.3 | ![]() |
QIVHLKRYF |
|||
![]() | W | E | e | 61.0 | ![]() |
homo | WLS |
||
![]() | V | E | b | 0.7 | ![]() |
VITDGL |
|||
![]() | P | E | b | 7.0 | ![]() |
PR |
|||
![]() | S | G | b | 3.1 | ![]() |
VASIQEY |
|||
![]() | T | G | e | 66.2 | ![]() |
SCTGAI |
|||
![]() | W | G | b | 13.5 | ![]() |
WP |
|||
![]() | L | T | e | 41.0 | ![]() |
VLI |
|||
![]() | R | e | 84.2 | ![]() |
RQ |