Contact Molecules for Homologous Proteins | ||||
![]() [Summary Bars] |
![]() [Full Bars] |
|
![]() [Back to Search Page] |
![]() [Back to HOMCOS] |
![]() [Sites by Variants] |
![]() [SupCon3D] |
![]() [help] |
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100] | ![]() [show] [download] [help] |
PID | QueryLength | Homolgous Sequence in PDB | UniProt Query | TITLE |
1598604 | 675 | 199 | Q8N3R9(PALS1_HUMAN) | RecName: Full=Protein PALS1 ;AltName: Full=MAGUK p55 subfamily member 5;AltName: Full=Membrane protein, palmitoylated 5 ;AltName: Full=Protein associated with Lin-7 1 ; |
QUERYSEQ |
MTTSHMNGHVTEESDSEVKNVDLASPEEHQKHREMAVDCPGDLGTRMMPIRRSAQLERIRQQQEDMRRRREEEGKKQELDLNSSMRLKKLAQIPPKTGIDNPMFDTEEGIVLESPHYAVKILEIEDLFSSLKHIQHTLVDSQSQEDISLL LQLVQNKDFQNAFKIHNAITVHMNKASPPFPLISNAQDLAQEVQTVLKPVHHKEGQELTALLNTPHIQALLLAHDKVAEQEMQLEPITDERVYESIGQYGGETVKIVRIEKARDIPLGATVRNEMDSVIISRIVKGGAAEKSGLLHEGDE VLEINGIEIRGKDVNEVFDLLSDMHGTLTFVLIPSQQIKPPPAKETVIHVKAHFDYDPSDDPYVPCRELGLSFQKGDILHVISQEDPNWWQAYREGDEDNQPLAGLVPGKSFQQQREAMKQTIEEDKEPEKSGKLWCAKKNKKKRKKVLY NANKNDDYDNEEILTYEEMSLYHQPANRKRPIILIGPQNCGQNELRQRLMNKEKDRFASAVPHTTRSRRDQEVAGRDYHFVSRQAFEADIAAGKFIEHGEFEKNLYGTSIDSVRQVINSGKICLLSLRTQSLKTLRNSDLKPYIIFIAPP SQERLRALLAKEGKNPKPEELREIIEKTREMEQNNGHYFDTAIVNSDLDKAYQELLRLINKLDTEPQWVPSTWLR |
[n]:site number of query sequence. [a]:amino acid of query sequence. [s]:predicted secondary structure. [e]:predicted exposed/buried. [acc]:predicted relative accesssibility(%). [pdb]:PDB code of homologous structure. [contact_mols]:predicted binding molecules [observed aa]:Observed amino acids among homologous sequences. [feature table]:UniProt Feature Table [variant]:UniProt Human Variant.
n | a | s | e | acc | pdb | contact_mols | observed aa | feature table | variant |
![]() | M | - | - | - | - | M |
REGION /note="Disordered" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED REGION /note="Disordered" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | T | - | - | - | - | T |
REGION /note="Disordered" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED REGION /note="Disordered" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | T | - | - | - | - | T |
REGION /note="Disordered" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED REGION /note="Disordered" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | S | - | - | - | - | S |
REGION /note="Disordered" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED REGION /note="Disordered" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | H | - | - | - | - | H |
REGION /note="Disordered" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED REGION /note="Disordered" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | M | - | - | - | - | M |
REGION /note="Disordered" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED REGION /note="Disordered" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | N | - | - | - | - | N |
REGION /note="Disordered" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED REGION /note="Disordered" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | G | - | - | - | - | G |
REGION /note="Disordered" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED REGION /note="Disordered" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | H | - | - | - | - | HY |
REGION /note="Disordered" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED REGION /note="Disordered" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | V | - | - | - | - | V |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" COMPBIAS /note="Basic and acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | T | - | - | - | - | T |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" COMPBIAS /note="Basic and acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | E | - | - | - | - | E |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" COMPBIAS /note="Basic and acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | E | - | - | - | - | ES |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" COMPBIAS /note="Basic and acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | S | - | - | - | - | SD |
MOD_RES /note="Phosphoserine" COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" MOD_RES /note="Phosphoserine" COMPBIAS /note="Basic and acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | D | - | - | - | - | DG |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" COMPBIAS /note="Basic and acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | S | - | - | - | - | SG |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" COMPBIAS /note="Basic and acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | E | - | - | - | - | EAGLSDIKNPQRTVCFHMY |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" COMPBIAS /note="Basic and acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | V | - | - | - | - | VAGLSDEIKNPQRTCFHMY |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" COMPBIAS /note="Basic and acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | K | - | - | - | - | KG |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" COMPBIAS /note="Basic and acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | N | - | - | - | - | NG |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" COMPBIAS /note="Basic and acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | V | - | - | - | - | VT |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" COMPBIAS /note="Basic and acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | D | - | - | - | - | D |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" COMPBIAS /note="Basic and acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | L | - | - | - | - | LI |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" COMPBIAS /note="Basic and acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | A | - | - | - | - | AV |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" COMPBIAS /note="Basic and acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | S | - | - | - | - | SE |
MOD_RES /note="Phosphoserine" ECO:0007744|PubMed:23186163" COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" MOD_RES /note="Phosphoserine" ECO:0007744|PubMed:23186163" COMPBIAS /note="Basic and acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | P | - | - | - | - | PAGLSDEIKNQRTVCFHMY |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" COMPBIAS /note="Basic and acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | E | - | - | - | - | E |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" COMPBIAS /note="Basic and acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | E | - | - | - | - | EG |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" COMPBIAS /note="Basic and acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | H | - | - | - | - | HV |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" COMPBIAS /note="Basic and acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | Q | - | - | - | - | Q |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | K | - | - | - | - | KR |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | H | - | - | - | - | H |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | R | - | - | - | - | R |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | E | - | - | - | - | E |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | M | - | - | - | - | M |
REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | A | - | - | - | - | A |
REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | V | - | - | - | - | V |
REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | D | - | - | - | - | D |
REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | C | - | - | - | - | C |
REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | P | - | - | - | - | P |
REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | G | - | - | - | - | GS |
REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | D | - | - | - | - | DE |
REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | L | - | - | - | - | L |
REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | G | - | - | - | - | G |
REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | T | - | - | - | - | TA |
REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | R | - | - | - | - | R |
REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | M | - | - | - | - | MT |
REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | M | - | - | - | - | ML |
REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | P | - | - | - | - | P |
REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | I | - | - | - | - | IV |
REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | R | - | - | - | - | R |
REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | R | - | - | - | - | RD |
REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | S | - | - | - | - | SR |
REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | A | - | - | - | - | AD |
REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | Q | - | - | - | - | QK |
REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | L | - | - | - | - | L |
REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | E | - | - | - | - | EQ |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | R | - | - | - | - | RK |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | I | - | - | - | - | IL |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | R | - | - | - | - | RA |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | Q | - | - | - | - | QD |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | Q | - | - | - | - | QT |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | Q | - | - | - | - | QV |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | E | - | - | - | - | E |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | D | - | - | - | - | DE |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | M | - | - | - | - | MLR |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | R | - | - | - | - | RK |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | R | - | - | - | - | R |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | R | - | - | - | - | R |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | R | - | - | - | - | RE |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | E | - | - | - | - | EK |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | E | - | - | - | - | EL |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | E | - | - | - | - | EKG |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | G | - | - | - | - | GR |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | K | - | - | - | - | KAS |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | K | - | - | - | - | KVR |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | Q | - | - | - | - | Q |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | E | - | - | - | - | EA |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | L | - | - | - | - | LI |
REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | D | - | - | - | - | DA |
REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | L | - | - | - | - | LG |
REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | N | - | - | - | - | NG |
REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | S | - | - | - | - | ST |
MOD_RES /note="Phosphoserine" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" MOD_RES /note="Phosphoserine" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | S | - | - | - | - | SN |
MOD_RES /note="Phosphoserine" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" MOD_RES /note="Phosphoserine" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | M | - | - | - | - | M |
REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | R | - | - | - | - | RD |
REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | L | - | - | - | - | L |
REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | K | - | - | - | - | KY |
REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | K | - | - | - | - | KA |
REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | L | - | - | - | - | LT |
REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | A | - | - | - | - | ADS |
REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | Q | - | - | - | - | QA |
REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | I | - | - | - | - | IDAGLSEFHKMNPQRTVY |
REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | P | - | - | - | - | PMN |
REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | P | - | - | - | - | P |
REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | K | - | - | - | - | KI |
REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | T | - | - | - | - | TV |
REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | G | - | - | - | - | G |
REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | I | - | - | - | - | IA |
REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | D | - | - | - | - | DT |
REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | N | - | - | - | - | ND |
REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | P | - | - | - | - | PE |
REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | M | - | - | - | - | MWT |
REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | F | - | - | - | - | FA |
REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | D | - | - | - | - | DE |
REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | T | - | - | - | - | TEQ |
REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | E | - | - | - | - | EM |
REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | E | - | - | - | - | EA |
REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | G | - | - | - | - | G |
REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | I | - | - | - | - | IP |
REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | V | - | - | - | - | VEG |
REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | L | - | - | - | - | LAGSDEIKNPQRTVCFHMWY |
REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | E | - | - | - | - | EQAGLSDIKNPRTVCFHMWY |
REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | S | - | - | - | - | SAGLDEIKNPQRTVCFHMWY |
REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | P | - | - | - | - | PLAGSDEIKNQRTVCFHMWY |
REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | H | - | - | - | - | HIAGLSDEKNPQRTVCFMWY |
REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | Y | - | - | - | - | YAGLSDEIKNPQRTVCFHMW |
REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | A | - | - | - | - | APGLSDEIKNQRTVCFHMWY |
REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | V | S | e | 70.7 | ![]() |
precipitant | VPAGLSDEIKNQRTCFHMWY |
REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
![]() | K | e | 47.6 | ![]() |
hetero MPDZ_RAT | AK |
DOMAIN /note="L27 1" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="L27 1" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | I | e | 21.6 | ![]() |
hetero MPDZ_RAT | IVL |
DOMAIN /note="L27 1" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="L27 1" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | L | b | 0.0 | ![]() |
hetero MPDZ_RAT | LQ |
DOMAIN /note="L27 1" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="L27 1" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | E | e | 46.7 | ![]() |
ER |
DOMAIN /note="L27 1" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="L27 1" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |||
![]() | I | H | b | 10.5 | ![]() |
IVL |
DOMAIN /note="L27 1" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="L27 1" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | E | H | e | 46.7 | ![]() |
ESL |
DOMAIN /note="L27 1" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="L27 1" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | D | H | e | 33.3 | ![]() |
hetero INADL_HUMAN MPDZ_RAT | DQ |
DOMAIN /note="L27 1" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="L27 1" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
![]() | L | H | b | 0.0 | ![]() |
hetero INADL_HUMAN MPDZ_RAT | LVC |
DOMAIN /note="L27 1" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="L27 1" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
![]() | F | H | e | 33.5 | ![]() |
LF |
DOMAIN /note="L27 1" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="L27 1" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | S | H | e | 39.1 | ![]() |
DSM |
DOMAIN /note="L27 1" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="L27 1" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | S | H | b | 0.0 | ![]() |
hetero INADL_HUMAN MPDZ_RAT | SD |
DOMAIN /note="L27 1" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="L27 1" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
![]() | L | H | b | 2.8 | ![]() |
LI |
DOMAIN /note="L27 1" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="L27 1" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | K | H | e | 69.3 | ![]() |
KEY |
DOMAIN /note="L27 1" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="L27 1" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | H | H | e | 33.5 | ![]() |
hetero INADL_HUMAN MPDZ_RAT | HESQ |
DOMAIN /note="L27 1" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="L27 1" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
![]() | I | H | b | 0.0 | ![]() |
hetero INADL_HUMAN MPDZ_RAT | ILV |
DOMAIN /note="L27 1" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="L27 1" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
![]() | Q | H | e | 45.4 | ![]() |
QAEGLSVDFHIKMNPRTY |
DOMAIN /note="L27 1" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="L27 1" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | H | H | e | 83.8 | ![]() |
HD |
DOMAIN /note="L27 1" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="L27 1" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | T | H | b | 15.6 | ![]() |
hetero INADL_HUMAN MPDZ_RAT | ATS |
DOMAIN /note="L27 1" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED DOMAIN /note="L27 1" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
![]() | L | b | 0.6 | ![]() |
hetero INADL_HUMAN MPDZ_RAT | LH |
DOMAIN /note="L27 1" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="L27 1" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | V | e | 75.3 | ![]() |
VTNI |
DOMAIN /note="L27 1" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="L27 1" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |||
![]() | D | S | e | 30.2 | ![]() |
hetero INADL_HUMAN MPDZ_RAT | D |
DOMAIN /note="L27 1" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED DOMAIN /note="L27 1" REGION /note="Interaction with PARD6B" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
![]() | S | H | e | 67.2 | ![]() |
SCA |
DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | Q | H | e | 42.3 | ![]() |
hetero INADL_HUMAN MPDZ_RAT | QNDEAFGIKLPRSTVY |
DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
![]() | S | H | b | 0.0 | ![]() |
hetero INADL_HUMAN MPDZ_RAT | SHV |
DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
![]() | Q | H | e | 35.2 | ![]() |
QELRKP |
DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | E | H | e | 54.8 | ![]() |
EKRD |
DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | D | H | b | 4.9 | ![]() |
hetero INADL_HUMAN MPDZ_RAT | DE |
DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
![]() | I | H | b | 0.6 | ![]() |
hetero INADL_HUMAN MPDZ_RAT | LVMIRADEGKNPQST |
DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
![]() | S | H | e | 51.6 | ![]() |
TSCGDEAIKLNPQRV |
DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | L | H | e | 32.0 | ![]() |
hetero MPDZ_RAT | FLADEGIKNPQRSTV |
DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
![]() | L | H | b | 0.0 | ![]() |
hetero INADL_HUMAN MPDZ_RAT | LMV |
DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
![]() | L | H | e | 27.5 | ![]() |
LWHRY |
DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | Q | H | e | 73.5 | ![]() |
DQRSA |
DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | L | H | e | 25.8 | ![]() |
hetero INADL_HUMAN MPDZ_RAT | LVMD |
DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
![]() | V | H | b | 0.0 | ![]() |
hetero MPDZ_RAT | FVLN |
DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
![]() | Q | H | e | 54.6 | ![]() |
QGHSR |
DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | N | e | 41.8 | ![]() |
hetero MPDZ_RAT | ESNLDK |
DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | K | H | e | 67.5 | ![]() |
homo | KPHQR |
DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
![]() | D | H | e | 25.3 | ![]() |
hetero INADL_HUMAN MPDZ_RAT homo | SWDQHG |
DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
![]() | F | H | b | 1.0 | ![]() |
hetero INADL_HUMAN MPDZ_RAT | LF |
DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
![]() | Q | H | e | 24.0 | ![]() |
HQLSG |
DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | N | H | e | 50.3 | ![]() |
hetero INADL_HUMAN MPDZ_RAT homo | SAYNQTK |
DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
![]() | A | H | b | 0.0 | ![]() |
hetero INADL_HUMAN MPDZ_RAT | LA |
DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
![]() | F | H | b | 0.0 | ![]() |
hetero INADL_HUMAN MPDZ_RAT | FLVM |
DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
![]() | K | H | e | 56.1 | ![]() |
homo | KDS |
DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
![]() | I | H | b | 9.4 | ![]() |
hetero INADL_HUMAN MPDZ_RAT homo precipitant | IRLV |
DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
![]() | H | H | b | 0.0 | ![]() |
hetero INADL_HUMAN MPDZ_RAT | HYI |
DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
![]() | N | H | b | 10.9 | ![]() |
EDNA |
DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | A | H | e | 32.1 | ![]() |
homo precipitant | KACS |
DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
![]() | I | H | b | 1.2 | ![]() |
hetero INADL_HUMAN MPDZ_RAT homo | LITV |
DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
![]() | T | H | b | 1.3 | ![]() |
hetero INADL_HUMAN | QRTVNAGLDEFIKPSY |
DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
![]() | V | H | e | 25.3 | ![]() |
VYTEHRCAGLDFIKNPQS |
DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | H | H | e | 72.8 | ![]() |
HYFTK |
DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | M | H | e | 45.9 | ![]() |
hetero MPDZ_RAT | SMEYKC |
DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
![]() | N | S | e | 22.4 | ![]() |
NYERSD |
DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | K | e | 62.3 | ![]() |
precipitant | KEQGPRC |
DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | A | e | 74.1 | ![]() |
KASRQP |
DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |||
![]() | S | S | e | 64.8 | ![]() |
hetero MPDZ_RAT | SLQANEDFGIKPRTVY |
DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED DOMAIN /note="L27 1" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
![]() | P | e | 89.1 | ![]() |
PNSAGLDEIKQRTVCFHMY |
REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |||
![]() | P | e | 32.6 | ![]() |
precipitant | PADEFGIKLNQRSTV |
DOMAIN /note="L27 2" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED DOMAIN /note="L27 2" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | F | e | 71.3 | ![]() |
precipitant | VTFASYLM |
DOMAIN /note="L27 2" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED DOMAIN /note="L27 2" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | P | e | 21.7 | ![]() |
PED |
DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |||
![]() | L | S | e | 51.7 | ![]() |
AVLID |
DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | I | e | 27.5 | ![]() |
LTVI |
DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |||
![]() | S | S | e | 71.1 | ![]() |
HQDSGPT |
DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | N | e | 37.6 | ![]() |
HSRGN |
DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |||
![]() | A | H | b | 0.0 | ![]() |
AC |
DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | Q | H | e | 33.7 | ![]() |
QARKMGVT |
DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | D | H | e | 61.7 | ![]() |
ADEITVS |
DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | L | H | b | 4.5 | ![]() |
LV |
DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | A | H | b | 3.6 | ![]() |
ALST |
DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | Q | H | e | 47.4 | ![]() |
EQDCYA |
DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | E | H | e | 37.2 | ![]() |
EDQ |
DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | V | H | b | 0.0 | ![]() |
VLI |
DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | Q | H | b | 5.1 | ![]() |
QSAMELVT |
DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | T | H | e | 42.9 | ![]() |
ETCSVDN |
DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | V | H | e | 23.3 | ![]() |
ETLVIYMK |
DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | L | H | b | 1.7 | ![]() |
LPV |
DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | K | T | e | 71.7 | ![]() |
KQREGP |
DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | P | T | e | 82.9 | ![]() |
APDGENSIKLRTV |
DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | V | b | 13.3 | ![]() |
SLAKVTPDEGINR |
DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |||
![]() | H | e | 86.4 | ![]() |
precipitant | SAEHNYGTDIKLPRV |
DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | H | S | e | 46.6 | ![]() |
HSNGADEIKLPRTV |
DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | K | S | e | 71.7 | ![]() |
precipitant | SKPNEV |
DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
![]() | E | H | b | 12.1 | ![]() |
EDGA |
DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | G | H | b | 2.4 | ![]() |
IGEALSV |
DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | Q | H | e | 53.1 | ![]() |
precipitant | QRGKLASV |
DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
![]() | E | H | e | 29.1 | ![]() |
precipitant | EG |
DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
![]() | L | H | b | 0.0 | ![]() |
LM |
DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | T | H | e | 24.0 | ![]() |
LRATVKMS |
DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | A | H | e | 41.1 | ![]() |
QKRATGSH |
DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | L | H | b | 9.0 | ![]() |
LIAMV |
DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | L | H | b | 1.1 | ![]() |
L |
DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | N | H | e | 52.7 | ![]() |
SQNAKT |
DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | T | S | e | 20.1 | ![]() |
TKAEDQ |
DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | P | H | e | 48.1 | ![]() |
PLS |
DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | H | H | b | 12.0 | ![]() |
precipitant | HNY |
DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
![]() | I | H | b | 1.2 | ![]() |
FLVMIC |
DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | Q | H | e | 36.2 | ![]() |
QKREM |
DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | A | H | b | 7.1 | ![]() |
ASH |
DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | L | H | b | 0.6 | ![]() |
LV |
DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | L | H | b | 1.1 | ![]() |
LM |
DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | L | H | e | 29.8 | ![]() |
SEMQLH |
DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | A | H | b | 0.0 | ![]() |
AVTKS |
DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | H | H | b | 1.0 | ![]() |
H |
DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | D | H | b | 9.3 | ![]() |
DN |
DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | K | H | e | 29.2 | ![]() |
TSVKRI |
DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | V | H | e | 25.3 | ![]() |
VPI |
DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | A | H | b | 11.6 | ![]() |
AE |
DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | E | S | e | 52.3 | ![]() |
QESPDK |
DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | Q | S | e | 66.8 | ![]() |
KQEV |
DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | E | S | e | 89.9 | ![]() |
SNEADTC |
DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | M | S | e | 58.0 | ![]() |
YFMLP |
DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | Q | - | - | - | - | DEQR |
DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | L | - | - | - | - | LVTS |
DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | E | - | - | - | - | PETLS |
DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED DOMAIN /note="L27 2" REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | P | S | e | 94.6 | ![]() |
PA |
REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | I | e | 64.3 | ![]() |
LPVMIS |
REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |||
![]() | T | S | e | 90.3 | ![]() |
PSLMTNV |
REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | D | e | 72.2 | ![]() |
DPEGY |
REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |||
![]() | E | e | 64.3 | ![]() |
DEGLSNA |
REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |||
![]() | R | e | 77.1 | ![]() |
NAIMLRSDEGKPTV |
REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |||
![]() | V | e | 110.0 | ![]() |
IDVGYNPAL |
REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |||
![]() | Y | S | e | 71.7 | ![]() |
YDPTEISNAL |
REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED REGION /note="Interaction with LIN7C" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | E | e | 66.8 | ![]() |
ETDNSPAGLVFHIKMQRY |
REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |||
![]() | S | E | e | 71.9 | ![]() |
SEFGLANTDIKPQRVY |
REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | I | E | e | 44.4 | ![]() |
ILSPDNFAEGKTVQRCHMWY |
REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | G | e | 64.3 | ![]() |
NGDATLEKSVFIPQRCHMWY |
REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |||
![]() | Q | e | 54.1 | ![]() |
QEAVDGLSIKNPRTCFHMY |
REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |||
![]() | Y | S | e | 110.0 | ![]() |
ILVYEFMWAGSDKNPQRTCH |
REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | G | S | e | 91.7 | ![]() |
GPAEMDLSVFIKNQRTCHWY |
REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | G | S | e | 66.7 | ![]() |
metal CL | GEPAVMDFIKLNQRST |
REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
![]() | E | e | 61.8 | ![]() |
metal CL | EDKPR |
REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | T | e | 58.4 | ![]() |
SATNDPKL |
REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |||
![]() | V | E | b | 6.0 | ![]() |
VHMTRIL |
REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | K | E | e | 20.3 | ![]() |
hetero CDC42_HUMAN metal CL | RK |
REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
![]() | I | E | b | 7.0 | ![]() |
LIVRM |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | V | E | b | 6.7 | ![]() |
VIL |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | R | E | e | 49.8 | ![]() |
precipitant | RQFGLKCAS |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
![]() | I | E | b | 2.9 | ![]() |
precipitant | IFLHSV |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
![]() | E | E | e | 58.8 | ![]() |
precipitant | KVERHQYCLP |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
![]() | K | E | b | 7.1 | ![]() |
hetero CRUM1_HUMAN CRB_DROME VEMP_SARS2 precipitant | KGR |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
![]() | A | B | e | 48.2 | ![]() |
metal CL homo | GSNAVTDK |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
![]() | R | T | e | 64.0 | ![]() |
compound PUN metal CL homo | TQKRLDASY |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
![]() | D | T | e | 75.3 | ![]() |
hetero CXG1_HUMAN JAM1_HUMAN metal UNX NA | EDGSQTAKLV |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
![]() | I | B | e | 54.4 | ![]() |
hetero CXG1_HUMAN JAM1_HUMAN homo | LEIVKRFADGNPQST |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
![]() | P | e | 63.6 | ![]() |
hetero VEMP_SARS2 NRX1A_HUMAN CRB_DROME VEMP_SARS CXG1_HUMAN JAM1_HUMAN CRUM1_HUMAN metal UNX homo precipitant | PGATDEHS |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | L | b | 8.4 | ![]() |
hetero VEMP_SARS2 NRX1A_HUMAN CRB_DROME VEMP_SARS GLPC_HUMAN CXG1_HUMAN JAM1_HUMAN CRUM1_HUMAN metal UNX homo precipitant | LIMF |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | G | S | b | 6.0 | ![]() |
hetero VEMP_SARS2 NRX1A_HUMAN CRB_DROME VEMP_SARS GLPC_HUMAN CXG1_HUMAN JAM1_HUMAN CRUM1_HUMAN homo precipitant | GREN |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
![]() | A | E | e | 30.4 | ![]() |
hetero VEMP_SARS2 NRX1A_HUMAN CRB_DROME VEMP_SARS GLPC_HUMAN JAM1_HUMAN CRUM1_HUMAN homo precipitant | AIVLGFS |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
![]() | T | E | b | 11.0 | ![]() |
hetero VEMP_SARS2 NRX1A_HUMAN CRB_DROME VEMP_SARS GLPC_HUMAN JAM1_HUMAN CRUM1_HUMAN metal UNX homo | TALYSGV |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
![]() | V | E | e | 29.3 | ![]() |
hetero VEMP_SARS2 NRX1A_HUMAN CRB_DROME VEMP_SARS GLPC_HUMAN JAM1_HUMAN CRUM1_HUMAN homo | IGLVCFAP |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
![]() | R | E | e | 31.6 | ![]() |
hetero VEMP_SARS2 CRB_DROME NRX1A_HUMAN VEMP_SARS GLPC_HUMAN CRUM1_HUMAN metal UNX homo precipitant | GRKSDYAEILPTV |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
![]() | N | E | e | 29.1 | ![]() |
hetero CRB_DROME VEMP_SARS2 metal UNX homo precipitant | NGDEKRSVHMAILPT |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
![]() | E | E | e | 20.6 | ![]() |
hetero CRB_DROME VEMP_SARS2 precipitant | DETNKPQAGILRSV |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
![]() | M | T | e | 50.7 | ![]() |
VGLFMIKTEDNAPRS |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | D | T | e | 42.0 | ![]() |
metal UNX homo | GDHEQPTSNALVFIKMRY |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
![]() | S | E | b | 3.1 | ![]() |
metal UNX homo | GPSAEKRDHL |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
![]() | V | E | b | 0.0 | ![]() |
metal UNX homo precipitant | IVCL |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
![]() | I | E | b | 8.2 | ![]() |
metal UNX homo | FYVILTMS |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
![]() | I | E | b | 2.3 | ![]() |
homo | VI |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
![]() | S | E | e | 22.7 | ![]() |
hetero VEMP_SARS2 VANG2_HUMAN CRB_DROME VEMP_SARS JAM1_HUMAN TAX_HTL1C homo precipitant | ASKG |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
![]() | R | E | b | 10.7 | ![]() |
hetero VANG2_HUMAN NRX1A_HUMAN CRB_DROME CXG1_HUMAN CRUM1_HUMAN VEMP_SARS2 TAX_HTL1C metal UNX homo precipitant | RGFEKNAS |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
![]() | I | E | b | 14.0 | ![]() |
hetero CXG1_HUMAN TAX_HTL1C homo | IVLM |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
![]() | V | b | 1.3 | ![]() |
hetero VEMP_SARS2 VEMP_SARS GLPC_HUMAN CXG1_HUMAN JAM1_HUMAN NRX1A_HUMAN TAX_HTL1C metal UNX homo precipitant | LVMQEITYAF |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | K | T | e | 23.1 | ![]() |
hetero TAX_HTL1C homo precipitant | PEHADKR |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
![]() | G | T | e | 23.8 | ![]() |
precipitant | GDR |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
![]() | G | S | b | 6.0 | ![]() |
homo precipitant | GST |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
![]() | A | H | e | 37.5 | ![]() |
homo precipitant | PLAMSVI |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
![]() | A | H | b | 0.0 | ![]() |
homo | AIV |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
![]() | E | H | e | 28.6 | ![]() |
hetero CDC42_HUMAN TAX_HTL1C homo precipitant | EDHKAIQ |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
![]() | K | H | e | 72.2 | ![]() |
hetero CDC42_HUMAN homo precipitant | RQGLSK |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
![]() | S | H | e | 35.2 | ![]() |
hetero CDC42_HUMAN homo precipitant | STQEPHDCAGN |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
![]() | G | T | e | 47.6 | ![]() |
hetero CDC42_HUMAN homo precipitant | GDAS |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
![]() | L | e | 32.0 | ![]() |
hetero CDC42_HUMAN homo precipitant | LGEAKTISRN |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | L | b | 2.2 | ![]() |
homo precipitant | LIVADEFGKNPQRST |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | H | e | 46.6 | ![]() |
homo precipitant | HKQVARMEYG |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | E | T | e | 28.6 | ![]() |
hetero TAX_HTL1C homo precipitant | VEPRAKIT |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
![]() | G | T | b | 17.9 | ![]() |
homo precipitant | GNS |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
![]() | D | b | 0.0 | ![]() |
homo precipitant | DM |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | E | E | b | 13.6 | ![]() |
homo precipitant | EQRLIKV |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
![]() | V | E | b | 2.0 | ![]() |
homo precipitant | ILV |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
![]() | L | E | b | 11.2 | ![]() |
metal UNX homo precipitant | LRIVKMA |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
![]() | E | E | e | 35.2 | ![]() |
metal UNX homo precipitant | ESAKQR |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
![]() | I | E | b | 1.2 | ![]() |
homo precipitant | VIYW |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
![]() | N | T | e | 43.0 | ![]() |
metal UNX homo precipitant | NG |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
![]() | G | T | e | 81.0 | ![]() |
metal UNX homo precipitant | GSNTD |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
![]() | I | E | e | 29.8 | ![]() |
homo | VIQLCMTHKS |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
![]() | E | E | e | 55.3 | ![]() |
metal UNX homo precipitant | DSPENAVT |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
![]() | I | b | 0.0 | ![]() |
metal UNX precipitant | VLFMI |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | R | T | e | 36.0 | ![]() |
metal UNX homo precipitant | RTAEKLQSD |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
![]() | G | T | e | 63.1 | ![]() |
metal UNX | GNSHDEA |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
![]() | K | e | 29.2 | ![]() |
metal UNX | KALRQVHIESN |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | D | e | 38.9 | ![]() |
metal UNX precipitant | TSRDPIHKNQ |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | V | H | e | 20.7 | ![]() |
hetero VEMP_SARS2 VANG2_HUMAN NRX1A_HUMAN VEMP_SARS GLPC_HUMAN JAM1_HUMAN CRUM1_HUMAN CRB_DROME TAX_HTL1C homo | HVPLREYQ |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
![]() | N | H | e | 62.4 | ![]() |
hetero VEMP_SARS2 CRB_DROME NRX1A_HUMAN VEMP_SARS CRUM1_HUMAN homo precipitant | EDSKNRG |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
![]() | E | H | e | 47.2 | ![]() |
metal UNX homo | EQADKHS |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
![]() | V | H | b | 6.0 | ![]() |
hetero CRB_DROME VEMP_SARS2 homo | VALI |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
![]() | F | H | e | 56.9 | ![]() |
hetero VEMP_SARS2 VANG2_HUMAN NRX1A_HUMAN CRB_DROME VEMP_SARS GLPC_HUMAN CXG1_HUMAN JAM1_HUMAN CRUM1_HUMAN TAX_HTL1C metal CL homo precipitant | VQIATYLFS |
MUTAGEN /note="F->A,C: Increases interaction with CRB1." DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" MUTAGEN /note="F->A,C: Increases interaction with CRB1." DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
![]() | D | H | e | 58.6 | ![]() |
homo precipitant | EQDHSAKVYLNRI |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
![]() | L | H | e | 26.4 | ![]() |
metal UNX homo | LIMAFE |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
![]() | L | H | b | 17.4 | ![]() |
hetero VEMP_SARS2 VANG2_HUMAN VEMP_SARS CXG1_HUMAN JAM1_HUMAN CRUM1_HUMAN CRB_DROME NRX1A_HUMAN metal UNX homo precipitant | LMI |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
![]() | S | H | e | 34.4 | ![]() |
hetero CXG1_HUMAN JAM1_HUMAN NRX1A_HUMAN VANG2_HUMAN TAX_HTL1C metal UNX NA homo precipitant | KALRSQTEIV |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
![]() | D | T | e | 81.5 | ![]() |
metal UNX NA homo | AQENDKMGIPVRST |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
![]() | M | b | 11.6 | ![]() |
metal UNX homo | ASPNLMTQRI |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | H | e | 47.1 | ![]() |
compound PUN metal UNX homo | GSKQPRDHCEAN |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | G | E | e | 27.4 | ![]() |
homo | GQEHPDNKR |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
![]() | T | E | e | 42.2 | ![]() |
homo precipitant | TSGNVAEMKQY |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
![]() | L | E | b | 0.0 | ![]() |
homo | VLIEMT |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
![]() | T | E | e | 24.7 | ![]() |
metal UNX homo precipitant | TISEKVRMD |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
![]() | F | E | b | 2.9 | ![]() |
homo precipitant | LFVITM |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
![]() | V | E | b | 16.7 | ![]() |
homo precipitant | KVTILQARE |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
![]() | L | E | b | 0.0 | ![]() |
homo | IVLYATG |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
![]() | I | E | b | 18.1 | ![]() |
homo | ILRAVKQFPMDEGST |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
![]() | P | e | 39.5 | ![]() |
homo | PQRYASTNDEFGIKLV |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | S | e | 24.2 | ![]() |
homo | SAGQRKVENIDLPT |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | Q | e | 37.8 | ![]() |
homo | SQEGYITADHRKNP |
DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DOMAIN /note="PDZ" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | Q | e | 41.8 | ![]() |
homo | QEKRSDFLP |
REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | I | e | 44.4 | ![]() |
homo | VILSTYDEKGPANFQR |
REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | K | e | 33.5 | ![]() |
homo | KERDAQISTFGP |
REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | P | e | 82.2 | ![]() |
homo | PLERAHGKSDWIQ |
REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | P | S | e | 90.7 | ![]() |
homo | PKADELGQSRTVYI |
REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | |
![]() | P | e | 103.9 | ![]() |
homo | PTAVCRGLMEKQ |
REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | A | e | 79.5 | ![]() |
homo | SRLGNACTYFQVI |
REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | K | e | 42.9 | ![]() |
homo | KRQSEADPFHLN |
REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | E | e | 70.9 | ![]() |
homo | ESGKQRANDVWILPT |
DOMAIN /note="SH3" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" DISORDER predicted by DISOPRED DOMAIN /note="SH3" REGION /note="Required for the correct localization of PALS1 and PATJ at cell-cell contacts and the normal formation of tight junctions and adherens junctions" | ||
![]() | T | e | 62.3 | ![]() |
homo | RGSDTAEIQKPLFNVY |
DOMAIN /note="SH3" DISORDER predicted by DISOPRED DOMAIN /note="SH3" | ||
![]() | V | e | 36.7 | ![]() |
homo | SKVMDQPTLAEFGINRY |
DOMAIN /note="SH3" DISORDER predicted by DISOPRED DOMAIN /note="SH3" | ||
![]() | I | E | e | 39.8 | ![]() |
homo | FVILMS |
DOMAIN /note="SH3" DISORDER predicted by DISOPRED DOMAIN /note="SH3" | |
![]() | H | E | e | 66.5 | ![]() |
homo | YFSHR |
DOMAIN /note="SH3" DISORDER predicted by DISOPRED DOMAIN /note="SH3" | |
![]() | V | E | e | 32.0 | ![]() |
homo precipitant | VIME |
DOMAIN /note="SH3" DISORDER predicted by DISOPRED DOMAIN /note="SH3" | |
![]() | K | E | e | 58.0 | ![]() |
hetero VAV_MOUSE homo | RKTQ |
DOMAIN /note="SH3" DISORDER predicted by DISOPRED DOMAIN /note="SH3" | |
![]() | A | b | 4.5 | ![]() |
hetero VAV_MOUSE homo | ASTCG |
DOMAIN /note="SH3" DISORDER predicted by DISOPRED DOMAIN /note="SH3" | ||
![]() | H | e | 73.3 | ![]() |
hetero VAV_MOUSE homo | LHDQM |
DOMAIN /note="SH3" DISORDER predicted by DISOPRED DOMAIN /note="SH3" | ||
![]() | F | S | e | 32.5 | ![]() |
hetero VAV_MOUSE GAB2_HUMAN homo | FAYIT |
DOMAIN /note="SH3" DISORDER predicted by DISOPRED DOMAIN /note="SH3" | |
![]() | D | e | 61.7 | ![]() |
homo | DEH |
DOMAIN /note="SH3" DISORDER predicted by DISOPRED DOMAIN /note="SH3" | ||
![]() | Y | B | b | 11.3 | ![]() |
hetero VAV_MOUSE GAB2_HUMAN homo | YERFLC |
DOMAIN /note="SH3" DISORDER predicted by DISOPRED DOMAIN /note="SH3" | |
![]() | D | e | 44.4 | ![]() |
hetero VAV_MOUSE homo | DENWLQY |
DOMAIN /note="SH3" DISORDER predicted by DISOPRED DOMAIN /note="SH3" | ||
![]() | P | G | b | 11.6 | ![]() |
homo | PAKRDEGILNQSTV |
DOMAIN /note="SH3" DOMAIN /note="SH3" | |
![]() | S | G | e | 51.6 | ![]() |
hetero GAB2_HUMAN VAV_MOUSE homo | ASKQTRENFL |
DOMAIN /note="SH3" DISORDER predicted by DISOPRED DOMAIN /note="SH3" | |
![]() | D | G | e | 58.6 | ![]() |
hetero VAV_MOUSE GAB2_HUMAN homo | EDKRPVMANQGILST |
DOMAIN /note="SH3" DOMAIN /note="SH3" | |
![]() | D | b | 8.0 | ![]() |
homo | DPTESNAGIKLQRV |
DOMAIN /note="SH3" DISORDER predicted by DISOPRED DOMAIN /note="SH3" | ||
![]() | P | S | e | 30.2 | ![]() |
PSGDKNREAFILQTV |
DOMAIN /note="SH3" DOMAIN /note="SH3" | ||
![]() | Y | e | 38.7 | ![]() |
LGAYDEQVCSFIKNPRT |
DOMAIN /note="SH3" DISORDER predicted by DISOPRED DOMAIN /note="SH3" | |||
![]() | V | b | 5.3 | ![]() |
ILAVFDEGKNPRSTCHMQY |
DOMAIN /note="SH3" DISORDER predicted by DISOPRED DOMAIN /note="SH3" | |||
![]() | P | S | e | 51.2 | ![]() |
hetero CRB_DROME VEMP_SARS2 | PALDEGIKRSTVCFHMNQY |
DOMAIN /note="SH3" DISORDER predicted by DISOPRED DOMAIN /note="SH3" | |
![]() | C | b | 10.7 | ![]() |
hetero CRB_DROME homo | CSDHLAEGKPTVFIMNQRY |
DOMAIN /note="SH3" DISORDER predicted by DISOPRED DOMAIN /note="SH3" | ||
![]() | R | G | e | 40.7 | ![]() |
homo | KQRMVAGPLDEISTCFHNY |
DOMAIN /note="SH3" DISORDER predicted by DISOPRED DOMAIN /note="SH3" | |
![]() | E | G | e | 68.3 | ![]() |
hetero GAB2_HUMAN CRB_DROME | EDQSFAGLIKNPRTVCHMY |
DOMAIN /note="SH3" DISORDER predicted by DISOPRED DOMAIN /note="SH3" | |
![]() | L | G | b | 14.6 | ![]() |
hetero CRB_DROME VEMP_SARS2 homo | ALPQMGSDEIKNRTVCFHY |
DOMAIN /note="SH3" DOMAIN /note="SH3" | |
![]() | G | B | e | 27.4 | ![]() |
homo | GAES |
DOMAIN /note="SH3" DISORDER predicted by DISOPRED DOMAIN /note="SH3" | |
![]() | L | b | 7.9 | ![]() |
homo | LIVAEGKST |
DOMAIN /note="SH3" DOMAIN /note="SH3" | ||
![]() | S | e | 41.4 | ![]() |
homo | SPGKAQRNCELTV |
DOMAIN /note="SH3" DOMAIN /note="SH3" | ||
![]() | F | B | b | 3.3 | ![]() |
homo | F |
DOMAIN /note="SH3" DOMAIN /note="SH3" | |
![]() | Q | e | 68.4 | ![]() |
homo | KQRNTSLA |
DOMAIN /note="SH3" DOMAIN /note="SH3" | ||
![]() | K | T | e | 67.5 | ![]() |
hetero VAV_MOUSE homo | KRFYTVAHQ |
DOMAIN /note="SH3" DOMAIN /note="SH3" | |
![]() | G | T | e | 36.9 | ![]() |
hetero VAV_MOUSE homo | GDR |
DOMAIN /note="SH3" DOMAIN /note="SH3" | |
![]() | D | e | 29.6 | ![]() |
homo | DEQ |
DOMAIN /note="SH3" DOMAIN /note="SH3" | ||
![]() | I | E | e | 35.1 | ![]() |
homo precipitant | IVFL |
DOMAIN /note="SH3" DOMAIN /note="SH3" | |
![]() | L | E | b | 3.9 | ![]() |
homo | LIF |
DOMAIN /note="SH3" DOMAIN /note="SH3" | |
![]() | H | E | b | 16.8 | ![]() |
homo | HQRYAE |
DOMAIN /note="SH3" DOMAIN /note="SH3" | |
![]() | V | E | b | 2.0 | ![]() |
homo precipitant | VI |
DOMAIN /note="SH3" DOMAIN /note="SH3" | |
![]() | I | E | b | 14.0 | ![]() |
homo | IVLMFT |
DOMAIN /note="SH3" DOMAIN /note="SH3" | |
![]() | S | E | b | 8.6 | ![]() |
hetero JAM1_HUMAN homo | DNSPE |
DOMAIN /note="SH3" DOMAIN /note="SH3" | |
![]() | Q | e | 42.3 | ![]() |
hetero CXG1_HUMAN JAM1_HUMAN homo precipitant | QAKNSTDCR |
DOMAIN /note="SH3" DOMAIN /note="SH3" | ||
![]() | E | S | e | 57.8 | ![]() |
hetero CXG1_HUMAN JAM1_HUMAN homo | SDGLEVNQ |
DOMAIN /note="SH3" DOMAIN /note="SH3" | |
![]() | D | S | e | 28.4 | ![]() |
hetero GAB2_HUMAN CXG1_HUMAN homo | DKYTVCH |
MUTAGEN /note="D->K: Reduces binding to Drosophila crb and causes incorrect PALS1 localization and cell polarity." DOMAIN /note="SH3" MUTAGEN /note="D->K: Reduces binding to Drosophila crb and causes incorrect PALS1 localization and cell polarity." DOMAIN /note="SH3" | |
![]() | P | T | e | 43.4 | ![]() |
hetero JAM1_HUMAN homo | PDAFLEHKSV |
DOMAIN /note="SH3" DOMAIN /note="SH3" | |
![]() | N | T | e | 23.0 | ![]() |
hetero GAB2_HUMAN VAV_MOUSE homo | GNETLDH |
DOMAIN /note="SH3" DOMAIN /note="SH3" | |
![]() | W | E | b | 7.2 | ![]() |
hetero GAB2_HUMAN VAV_MOUSE homo | WSHL |
DOMAIN /note="SH3" DOMAIN /note="SH3" | |
![]() | W | E | b | 15.5 | ![]() |
homo precipitant | W |
DOMAIN /note="SH3" DOMAIN /note="SH3" | |
![]() | Q | E | b | 3.6 | ![]() |
hetero JAM1_HUMAN | QLKMT |
DOMAIN /note="SH3" DOMAIN /note="SH3" | |
![]() | A | E | b | 0.0 | ![]() |
AG |
DOMAIN /note="SH3" DOMAIN /note="SH3" | ||
![]() | Y | E | b | 18.7 | ![]() |
homo precipitant | RKVWAISGYH |
DOMAIN /note="SH3" DOMAIN /note="SH3" | |
![]() | R | E | e | 20.2 | ![]() |
homo precipitant | RKLVHCQSADEGT |
DOMAIN /note="SH3" DOMAIN /note="SH3" | |
![]() | E | T | e | 62.8 | ![]() |
homo precipitant | VEIQMHRDL |
DOMAIN /note="SH3" DOMAIN /note="SH3" | |
![]() | G | T | e | 71.4 | ![]() |
homo precipitant | GTLHANSM |
DOMAIN /note="SH3" DOMAIN /note="SH3" | |
![]() | D | e | 22.8 | ![]() |
homo precipitant | DNPSRGKQEALIV |
DOMAIN /note="SH3" DOMAIN /note="SH3" | ||
![]() | E | e | 96.0 | ![]() |
precipitant | EDNSTAHGLPKQ |
DOMAIN /note="SH3" DOMAIN /note="SH3" | ||
![]() | D | S | e | 59.9 | ![]() |
GNLDAHSTEKIPQRV |
DOMAIN /note="SH3" DOMAIN /note="SH3" | ||
![]() | N | e | 55.2 | ![]() |
hetero | EANLRDIKMSTGFPQV |
DOMAIN /note="SH3" DOMAIN /note="SH3" | ||
![]() | Q | e | 47.4 | ![]() |
homo | EQSRFKLTAVGNDHIMPY |
DOMAIN /note="SH3" DOMAIN /note="SH3" | ||
![]() | P | e | 58.9 | ![]() |
hetero VAV_MOUSE | EPKQVDTIAGLNRSCFHMY |
DOMAIN /note="SH3" DOMAIN /note="SH3" | ||
![]() | L | S | e | 21.3 | ![]() |
hetero VAV_MOUSE CRB_DROME homo | EIRCLADQSVFGKTHMNPY |
DOMAIN /note="SH3" DOMAIN /note="SH3" | |
![]() | A | b | 4.5 | ![]() |
hetero VAV_MOUSE JAM1_HUMAN homo | ARQTIMNEVGL |
DOMAIN /note="SH3" DOMAIN /note="SH3" | ||
![]() | G | E | b | 10.7 | ![]() |
hetero VAV_MOUSE homo | GY |
DOMAIN /note="SH3" DOMAIN /note="SH3" | |
![]() | L | E | b | 0.6 | ![]() |
hetero VAV_MOUSE homo | LVIQYF |
DOMAIN /note="SH3" DOMAIN /note="SH3" | |
![]() | V | E | b | 1.3 | ![]() |
hetero VAV_MOUSE homo | IVFT |
DOMAIN /note="SH3" DOMAIN /note="SH3" | |
![]() | P | E | b | 17.1 | ![]() |
hetero VAV_MOUSE homo precipitant | P |
DOMAIN /note="SH3" DOMAIN /note="SH3" | |
![]() | G | b | 10.7 | ![]() |
homo | SNLG |
DOMAIN /note="SH3" DOMAIN /note="SH3" | ||
![]() | K | e | 47.6 | ![]() |
homo | KQNP |
DOMAIN /note="SH3" DOMAIN /note="SH3" | ||
![]() | S | H | e | 24.9 | ![]() |
homo | SRYEHKNQLFG |
DOMAIN /note="SH3" DOMAIN /note="SH3" | |
![]() | F | H | e | 34.0 | ![]() |
homo | RLFVW |
DOMAIN /note="SH3" DOMAIN /note="SH3" | |
![]() | Q | H | b | 2.0 | ![]() |
homo | QVAEMRK |
DOMAIN /note="SH3" DOMAIN /note="SH3" | |
![]() | Q | H | b | 16.1 | ![]() |
homo | EKDQR |
DOMAIN /note="SH3" DISORDER predicted by DISOPRED DOMAIN /note="SH3" | |
![]() | Q | H | e | 36.0 | ![]() |
homo | QRKWLE |
DOMAIN /note="SH3" DISORDER predicted by DISOPRED DOMAIN /note="SH3" | |
![]() | R | H | e | 36.4 | ![]() |
homo | RKLEMQ |
DOMAIN /note="SH3" DISORDER predicted by DISOPRED DOMAIN /note="SH3" | |
![]() | E | H | e | 35.2 | ![]() |
homo | EAFLVDKRIT |
DOMAIN /note="SH3" DISORDER predicted by DISOPRED DOMAIN /note="SH3" | |
![]() | A | S | e | 68.0 | ![]() |
ASPRFWL |
DISORDER predicted by DISOPRED | ||
![]() | M | S | e | 81.3 | ![]() |
homo | LRVSCFTYMWAG |
DISORDER predicted by DISOPRED | |
![]() | K | e | 86.7 | ![]() |
homo | RQKLEVDGITAMWFNPSY |
DISORDER predicted by DISOPRED | ||
![]() | Q | e | 61.7 | ![]() |
RLKQAESYNGTDFIPV |
DISORDER predicted by DISOPRED | |||
![]() | T | e | 102.6 | ![]() |
TASEKPRNVHMQDFGIL |
DISORDER predicted by DISOPRED | |||
![]() | I | - | - | - | - | VLMQAIGSTWDKE |
DISORDER predicted by DISOPRED | ||
![]() | E | - | - | - | - | EKSRGPQALDWFTV |
DISORDER predicted by DISOPRED | ||
![]() | E | - | - | - | - | ERKATFSQNPDIGLV |
DISORDER predicted by DISOPRED | ||
![]() | D | - | - | - | - | NTSDVLAGPIREFKQ |
DISORDER predicted by DISOPRED | ||
![]() | K | - | - | - | - | KASNPREGLYVDIT |
DISORDER predicted by DISOPRED | ||
![]() | E | - | - | - | - | GEQSDAKNRFILPTV |
DISORDER predicted by DISOPRED | ||
![]() | P | - | - | - | - | PGDSALETFHKRINQV |
DISORDER predicted by DISOPRED | ||
![]() | E | - | - | - | - | QGDNSEHLRTACPFIKVY |
DISORDER predicted by DISOPRED | ||
![]() | K | - | - | - | - | RTKADFPSVGNQLEIY |
DISORDER predicted by DISOPRED | ||
![]() | S | - | - | - | - | SARTEKNQLDFGIPVY |
DISORDER predicted by DISOPRED | ||
![]() | G | - | - | - | - | GASFKTQRCHLDEINPVY |
DISORDER predicted by DISOPRED | ||
![]() | K | H | e | 55.3 | ![]() |
EKDRSTLGQCVFMAINPY |
DISORDER predicted by DISOPRED | ||
![]() | L | H | e | 35.6 | ![]() |
LFTSIRVDMQAEGKNPY |
DISORDER predicted by DISOPRED | ||
![]() | W | H | e | 54.6 | ![]() |
homo | WFSLDGREKYAINPQTV |
DISORDER predicted by DISOPRED | |
![]() | C | H | e | 62.5 | ![]() |
CSGARFLNPTY |
DISORDER predicted by DISOPRED | ||
![]() | A | H | e | 21.3 | ![]() |
SAGRLQVDKNFM |
DISORDER predicted by DISOPRED | ||
![]() | K | H | b | 13.8 | ![]() |
KRSAPIELTDGV |
DISORDER predicted by DISOPRED | ||
![]() | K | H | b | 5.3 | ![]() |
KRFSLIDM |
DISORDER predicted by DISOPRED | ||
![]() | N | H | e | 24.1 | ![]() |
NSGTKRDFLP |
DISORDER predicted by DISOPRED | ||
![]() | K | H | e | 31.6 | ![]() |
KLRSGFVTNDEP |
DISORDER predicted by DISOPRED | ||
![]() | K | H | e | 41.0 | ![]() |
KRQSEFGHVDNTY |
DISORDER predicted by DISOPRED | ||
![]() | K | H | e | 23.6 | ![]() |
homo | KGRFQYSCDEILT |
DISORDER predicted by DISOPRED | |
![]() | R | H | e | 21.7 | ![]() |
homo | RSKETLHNDV |
DISORDER predicted by DISOPRED | |
![]() | K | T | e | 74.1 | ![]() |
homo | KRLETDYNPACIV |
DISORDER predicted by DISOPRED | |
![]() | K | T | e | 68.4 | ![]() |
KERAFDSGHNP |
DISORDER predicted by DISOPRED | ||
![]() | V | e | 71.3 | ![]() |
DVSMLFGYAHRPNEIKQT |
DISORDER predicted by DISOPRED | |||
![]() | L | - | - | - | - | LMKFPSGTIQADERV |
DISORDER predicted by DISOPRED | ||
![]() | Y | e | 97.2 | ![]() |
YSFTAHNQVIDEGKLPR |
DISORDER predicted by DISOPRED | |||
![]() | N | e | 63.1 | ![]() |
ALETDKNGIMQFYPRSV |
DISORDER predicted by DISOPRED | |||
![]() | A | S | e | 85.9 | ![]() |
ACLQRGSTDKV |
DISORDER predicted by DISOPRED | ||
![]() | N | e | 60.9 | ![]() |
KGSTNPVDAERL |
DISORDER predicted by DISOPRED | |||
![]() | K | e | 77.3 | ![]() |
KGHRSVEFADMNL |
DISORDER predicted by DISOPRED | |||
![]() | N | e | 69.8 | ![]() |
SNQDEGRVFPL |
DISORDER predicted by DISOPRED | |||
![]() | D | S | e | 67.2 | ![]() |
DSAEGTQLPIKNRV |
DISORDER predicted by DISOPRED | ||
![]() | D | e | 95.9 | ![]() |
homo | GQDIKSEALTHRVFNP |
DISORDER predicted by DISOPRED | ||
![]() | Y | e | 76.2 | ![]() |
homo | FYGRHNASMDEIKLPQTV |
DISORDER predicted by DISOPRED | ||
![]() | D | e | 94.5 | ![]() |
homo | DPSEQARVGKFILNT |
DISORDER predicted by DISOPRED | ||
![]() | N | e | 87.4 | ![]() |
NSTQAERPGDL |
DISORDER predicted by DISOPRED | |||
![]() | E | e | 29.1 | ![]() |
homo | ELDQYAHTKMP |
DISORDER predicted by DISOPRED | ||
![]() | E | e | 87.4 | ![]() |
homo | EDSKQRVTAY |
DISORDER predicted by DISOPRED | ||
![]() | I | e | 49.7 | ![]() |
homo | VILRMFAC |
DISORDER predicted by DISOPRED | ||
![]() | L | e | 61.2 | ![]() |
homo | LVPMQIRTWA |
DISORDER predicted by DISOPRED | ||
![]() | T | S | e | 90.3 | ![]() |
homo | TSVAILCG |
DISORDER predicted by DISOPRED | |
![]() | Y | S | e | 88.7 | ![]() |
homo | YFLIQ |
DISORDER predicted by DISOPRED | |
![]() | E | e | 48.2 | ![]() |
homo | ERFQL |
DISORDER predicted by DISOPRED | ||
![]() | E | e | 61.8 | ![]() |
homo | EDPRKNTAGLSV |
DISORDER predicted by DISOPRED | ||
![]() | M | E | e | 33.8 | ![]() |
homo | VMATNSCLDEGIKPR |
DISORDER predicted by DISOPRED | |
![]() | S | E | b | 18.0 | ![]() |
homo | SATVEGLNMIP |
||
![]() | L | E | e | 39.9 | ![]() |
homo | LVFRKPTMADEGINQS |
||
![]() | Y | E | b | 19.1 | ![]() |
homo | YLSVAEITWGDFHKMNPQR |
||
![]() | H | e | 64.9 | ![]() |
homo | HRQSYAKNGLDEFIPTV |
|||
![]() | Q | b | 10.2 | ![]() |
homo | QRMESLKHDGIATV |
|||
![]() | P | e | 36.4 | ![]() |
PETKRIVQADMSGLN |
||||
![]() | A | T | e | 75.0 | ![]() |
homo | ASVGPTDILQREHNK |
||
![]() | N | T | e | 58.8 | ![]() |
homo | NDFGHSEIQRATCPVYKL |
||
![]() | R | S | e | 36.4 | ![]() |
homo | RKYFQSAELPDGNV |
||
![]() | K | b | 13.7 | ![]() |
metal UNX homo precipitant | GKRPASVTEHQY |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
![]() | R | b | 1.6 | ![]() |
homo precipitant | RKLNQGMSTV |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
![]() | P | b | 0.0 | ![]() |
homo | LPTGIMVN |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
![]() | I | E | b | 0.0 | ![]() |
homo | VILFTYM |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |
![]() | I | E | b | 0.0 | ![]() |
homo | VILTEMAF |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |
![]() | L | E | b | 0.0 | ![]() |
homo | LIVFM |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |
![]() | I | E | b | 1.8 | ![]() |
metal UNX homo | SILFVTACM |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |
![]() | G | S | e | 21.4 | ![]() |
compound 5GP metal UNX homo precipitant | GAS |
BINDING /ligand="ATP" /ligand_id="ChEBI:CHEBI:30616" DOMAIN /note="Guanylate kinase-like" BINDING /ligand="ATP" /ligand_id="ChEBI:CHEBI:30616" DOMAIN /note="Guanylate kinase-like" | |
![]() | P | b | 1.6 | ![]() |
compound ADP 0O2 metal UNX homo precipitant | PAS |
BINDING /ligand="ATP" /ligand_id="ChEBI:CHEBI:30616" DOMAIN /note="Guanylate kinase-like" BINDING /ligand="ATP" /ligand_id="ChEBI:CHEBI:30616" DOMAIN /note="Guanylate kinase-like" | ||
![]() | Q | T | e | 60.7 | ![]() |
hetero CRB_DROME compound ADP G5P 5GP GDP 0O2 AGS homo precipitant | SILVATMQEHP |
BINDING /ligand="ATP" /ligand_id="ChEBI:CHEBI:30616" DOMAIN /note="Guanylate kinase-like" BINDING /ligand="ATP" /ligand_id="ChEBI:CHEBI:30616" DOMAIN /note="Guanylate kinase-like" | |
![]() | N | T | e | 60.0 | ![]() |
hetero E9Q4K7_MOUSE compound ADP G5P GMP 0O2 AGS 5GP homo precipitant | GAKNELSVDFHIMPQRTY |
BINDING /ligand="ATP" /ligand_id="ChEBI:CHEBI:30616" DOMAIN /note="Guanylate kinase-like" BINDING /ligand="ATP" /ligand_id="ChEBI:CHEBI:30616" DOMAIN /note="Guanylate kinase-like" | |
![]() | C | T | b | 4.0 | ![]() |
hetero L2GL2_HUMAN E9Q4K7_MOUSE compound ADP G5P 0O2 AGS 5GP metal UNX homo precipitant | VATCSDGELFHIKMNPQRY |
BINDING /ligand="ATP" /ligand_id="ChEBI:CHEBI:30616" DOMAIN /note="Guanylate kinase-like" BINDING /ligand="ATP" /ligand_id="ChEBI:CHEBI:30616" DOMAIN /note="Guanylate kinase-like" | |
![]() | G | T | b | 10.7 | ![]() |
compound ADP G5P 5GP 0O2 AGS metal UNX homo precipitant | GRAEHLSVDFIKMNPQTY |
BINDING /ligand="ATP" /ligand_id="ChEBI:CHEBI:30616" DOMAIN /note="Guanylate kinase-like" BINDING /ligand="ATP" /ligand_id="ChEBI:CHEBI:30616" DOMAIN /note="Guanylate kinase-like" | |
![]() | Q | H | b | 6.1 | ![]() |
compound 5GP ADP G5P GDP 0O2 AGS metal UNX homo precipitant | KALRQV |
BINDING /ligand="ATP" /ligand_id="ChEBI:CHEBI:30616" DOMAIN /note="Guanylate kinase-like" BINDING /ligand="ATP" /ligand_id="ChEBI:CHEBI:30616" DOMAIN /note="Guanylate kinase-like" | |
![]() | N | H | e | 50.3 | ![]() |
hetero CRB_DROME compound ADP G5P GDP 0O2 AGS metal UNX homo precipitant | SDTGNRHAKL |
BINDING /ligand="ATP" /ligand_id="ChEBI:CHEBI:30616" DOMAIN /note="Guanylate kinase-like" BINDING /ligand="ATP" /ligand_id="ChEBI:CHEBI:30616" DOMAIN /note="Guanylate kinase-like" | |
![]() | E | H | e | 51.8 | ![]() |
hetero L2GL2_HUMAN MAP1A_MOUSE compound ADP G5P AGS metal UNX homo precipitant | TSEVIAHRDL |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |
![]() | L | H | b | 0.0 | ![]() |
LVIAFGS |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
![]() | R | H | e | 22.1 | ![]() |
hetero CRB_DROME metal UNX | VRIKALMNCESTDGPQ |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |
![]() | Q | H | e | 46.9 | ![]() |
hetero CRB_DROME metal UNX precipitant | KERQNSADHGVLT |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |
![]() | R | H | e | 29.2 | ![]() |
homo precipitant | AKRMEDLQTGHVCFINSY |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |
![]() | L | H | b | 0.0 | ![]() |
homo | LIVKMACFTW |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |
![]() | M | H | e | 21.3 | ![]() |
hetero E9Q4K7_MOUSE MAP1A_MOUSE homo precipitant | LAIVFTMRYCEPQS |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |
![]() | N | H | e | 70.3 | ![]() |
homo | ESNRADKTQGVILHM |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |
![]() | K | H | e | 64.6 | ![]() |
homo | EQKRDTSAINGLWCFHMPVY |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |
![]() | E | T | e | 23.6 | ![]() |
metal UNX homo | EDFAKNHMPQRLVISTYCG |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |
![]() | K | T | e | 27.4 | ![]() |
compound ADP GMP G5P metal UNX homo precipitant | PKDSTELMNQAFGHRVCIY |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |
![]() | D | T | e | 75.3 | ![]() |
compound ADP metal UNX homo | DESLNTGPQAHFIRVY |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |
![]() | R | T | e | 21.7 | ![]() |
metal UNX homo | KRIQLDENAGHSVPTYCM |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |
![]() | F | E | b | 2.4 | ![]() |
compound GMP G5P ADP homo | FLYIVMQWHKNRS |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |
![]() | A | E | b | 18.8 | ![]() |
hetero homo precipitant | QAGERTCVKSLFHYDIMNW |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |
![]() | S | e | 50.8 | ![]() |
hetero CRB_DROME L2GL2_HUMAN E9Q4K7_MOUSE MAP1A_MOUSE metal K UNX homo precipitant | ISYLFRTVQKADEGHMP |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
![]() | A | b | 8.0 | ![]() |
hetero L2GL2_HUMAN E9Q4K7_MOUSE metal UNX homo precipitant | SACLTGPEIVDKR |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
![]() | V | b | 20.0 | ![]() |
hetero E9Q4K7_MOUSE metal UNX homo precipitant | VIPKALNTRCDEFGQSY |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
![]() | P | e | 20.9 | ![]() |
hetero L2GL2_HUMAN Q9NH88_DROME CRB_DROME E9Q4K7_MOUSE MAP1A_MOUSE compound 5GP GDP G5P LGP 0O2 metal K homo precipitant | SPLECTADFGIKNQRVY |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
![]() | H | E | b | 12.0 | ![]() |
homo precipitant | HAEKYDVMFLTCSGINPQRW |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |
![]() | T | E | b | 0.0 | ![]() |
homo | TEPVLFCSADGIKNQR |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |
![]() | T | b | 11.7 | ![]() |
homo | TSRMIADEFGKLNPQVY |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
![]() | R | S | b | 9.5 | ![]() |
hetero L2GL2_HUMAN CRB_DROME Q9NH88_DROME E9Q4K7_MOUSE MAP1A_MOUSE compound 5GP GDP G5P LGP 0O2 homo precipitant | RKDVMAEFGILNPQSTY |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |
![]() | S | e | 79.7 | ![]() |
homo precipitant | APSKQEGTDFILNRVHY |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
![]() | R | e | 53.8 | ![]() |
homo precipitant | PKRGMAQIVDEFLNST |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
![]() | R | e | 54.9 | ![]() |
hetero L2GL2_HUMAN CRB_DROME E9Q4K7_MOUSE compound 5GP GDP G5P LGP 0O2 homo precipitant | RTKSYADEFGILNPQV |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
![]() | D | T | e | 95.1 | ![]() |
hetero E9Q4K7_MOUSE homo precipitant | DPESKGFALNQRVCHIT |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |
![]() | Q | T | e | 93.9 | ![]() |
hetero E9Q4K7_MOUSE homo precipitant | GPQYSEKADNHLMTFIRV |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |
![]() | E | b | 16.6 | ![]() |
hetero homo precipitant | DEKRALFGINPQSTVY |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
![]() | V | e | 44.7 | ![]() |
homo precipitant | VIQDREKSTAGMLNCHP |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
![]() | A | T | e | 51.8 | ![]() |
homo precipitant | DENHAPSGIKLQRTV |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |
![]() | G | T | e | 52.4 | ![]() |
homo | GRADSEIKLNPTV |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |
![]() | R | T | e | 63.2 | ![]() |
hetero CRB_DROME Q9NH88_DROME L2GL2_HUMAN E9Q4K7_MOUSE homo precipitant | VKREQISTLADFGHMNP |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |
![]() | D | T | e | 27.2 | ![]() |
hetero CRB_DROME Q9NH88_DROME L2GL2_HUMAN E9Q4K7_MOUSE homo precipitant | DHENSAGLFIKPQRTVY |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |
![]() | Y | e | 26.1 | ![]() |
hetero L2GL2_HUMAN CRB_DROME Q9NH88_DROME E9Q4K7_MOUSE MAP1A_MOUSE compound 5GP GDP G5P LGP 0O2 metal K homo precipitant | YHLADEFGIKNPQRSTV |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
![]() | H | E | e | 30.9 | ![]() |
homo precipitant | HFYRNISAKLVDEGPQTW |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |
![]() | F | E | e | 20.6 | ![]() |
homo | FYLADEGIKNPQRSTV |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |
![]() | V | e | 25.3 | ![]() |
homo precipitant | VILKRTQMACDEFGHNPS |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
![]() | S | e | 58.6 | ![]() |
metal UNX homo precipitant | STDAEINPGKLQRV |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
![]() | R | H | e | 21.3 | ![]() |
metal UNX homo precipitant | RKVEQAPHDINTGLMS |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |
![]() | Q | H | e | 50.0 | ![]() |
metal UNX homo precipitant | EDAQKSTGHLPRINV |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |
![]() | A | H | e | 32.1 | ![]() |
homo | EATQVRKDLSCGHIMNP |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |
![]() | F | H | b | 0.0 | ![]() |
homo | FMIELADGKNPQRSTVY |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |
![]() | E | H | b | 6.5 | ![]() |
homo precipitant | EKQRDLAIPTVHMCGNSW |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |
![]() | A | H | e | 37.5 | ![]() |
metal UNX homo precipitant | AREKQTSDNGCHILMPVY |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |
![]() | D | H | b | 17.3 | ![]() |
homo precipitant | LMDGRKAEQSCINPTVW |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |
![]() | I | H | e | 24.6 | ![]() |
hetero Q9NH88_DROME homo precipitant | IVLRAECGKTDFHMNPQS |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |
![]() | A | H | e | 55.4 | ![]() |
homo precipitant | ADEKSQGNRFHLTVY |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |
![]() | A | T | e | 60.7 | ![]() |
homo precipitant | ASENDQKPRGMHTCIL |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |
![]() | G | T | e | 52.4 | ![]() |
hetero Q9NH88_DROME homo | GNDSECHKALQRV |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |
![]() | K | e | 47.2 | ![]() |
homo precipitant | EKDAGQLIRFNCHMSTVY |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
![]() | F | E | b | 4.8 | ![]() |
hetero Q9NH88_DROME homo precipitant | FLIMYACGSV |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |
![]() | I | E | b | 1.8 | ![]() |
hetero Q9NH88_DROME homo precipitant | LIVRAFGMSY |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |
![]() | E | E | e | 20.1 | ![]() |
hetero CRB_DROME Q9NH88_DROME L2GL2_HUMAN E9Q4K7_MOUSE MAP1A_MOUSE compound 5GP GDP G5P LGP 0O2 metal UNX homo precipitant | EKLDAGSV |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |
![]() | H | E | e | 39.3 | ![]() |
hetero Q9NH88_DROME L2GL2_HUMAN compound GDP LGP metal UNX homo precipitant | WYHSAFTVCDEGIKLNPQR |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |
![]() | G | E | e | 38.1 | ![]() |
hetero L2GL2_HUMAN CRB_DROME Q9NH88_DROME E9Q4K7_MOUSE MAP1A_MOUSE compound 5GP GDP G5P LGP 0O2 homo precipitant | AGKEVFTLNSDIPQRY |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |
![]() | E | E | e | 27.1 | ![]() |
hetero L2GL2_HUMAN Q9NH88_DROME E9Q4K7_MOUSE MAP1A_MOUSE metal MG homo precipitant | EKQRSTLNFGHAMVYCDIP |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |
![]() | F | E | e | 55.5 | ![]() |
hetero L2GL2_HUMAN CRB_DROME Q9NH88_DROME E9Q4K7_MOUSE MAP1A_MOUSE compound 5GP GDP G5P 0O2 LGP metal MG homo precipitant | VYFILRHASDEGKNPQT |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |
![]() | E | T | e | 52.3 | ![]() |
hetero E9Q4K7_MOUSE compound 5GP homo precipitant | FHEYASVGKQLNCDIPRT |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |
![]() | K | T | e | 42.9 | ![]() |
precipitant | GDNKESRTAILPQV |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |
![]() | N | E | e | 25.5 | ![]() |
homo precipitant | NHSDEGRAQTYIKLPV |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |
![]() | L | E | b | 4.5 | ![]() |
hetero L2GL2_HUMAN homo | YFLSRCMKWHINADEGPQTV |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |
![]() | Y | E | b | 16.5 | ![]() |
hetero L2GL2_HUMAN CRB_DROME Q9NH88_DROME E9Q4K7_MOUSE MAP1A_MOUSE compound 5GP GDP G5P LGP 0O2 homo precipitant | YGDKFSAEHILNPQRTV |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |
![]() | G | E | b | 6.0 | ![]() |
hetero MAP1A_MOUSE compound 5GP GDP G5P 0O2 LGP homo precipitant | GVADEIKLNPRST |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |
![]() | T | E | b | 14.3 | ![]() |
hetero CRB_DROME L2GL2_HUMAN MAP1A_MOUSE compound 5GP GDP G5P LGP 0O2 metal UNX homo precipitant | TVLISADEGKNPR |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |
![]() | S | E | b | 4.7 | ![]() |
metal UNX homo precipitant | SPLRAKNTEGI |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |
![]() | I | H | b | 14.0 | ![]() |
homo | RKLVIAFQTEGHMY |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |
![]() | D | H | e | 54.9 | ![]() |
homo precipitant | DAEKSQNGPRTVHL |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |
![]() | S | H | b | 4.7 | ![]() |
metal UNX homo | PTSAEQYWVFDGHIKNR |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |
![]() | V | H | b | 0.0 | ![]() |
homo | VILASTM |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |
![]() | R | H | e | 30.0 | ![]() |
metal UNX homo | ERKQDLNHMAFISTV |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |
![]() | Q | H | e | 68.4 | ![]() |
homo | EQKADRGNTVPSFILMY |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |
![]() | V | H | b | 10.7 | ![]() |
compound G5P homo precipitant | IAVQTLRKMNEFGHY |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |
![]() | I | H | b | 11.1 | ![]() |
homo | LIAMTHRVWEFQS |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |
![]() | N | T | e | 52.7 | ![]() |
metal UNX homo | AEDKNSQRTGHILV |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |
![]() | S | T | e | 57.0 | ![]() |
compound GMP G5P homo precipitant | QKASERDTNLVHM |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |
![]() | G | T | e | 34.5 | ![]() |
homo | GDNEKSV |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |
![]() | K | S | e | 30.7 | ![]() |
compound GMP G5P homo | KRIQHLVEFNCDGMPSTY |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |
![]() | I | E | b | 3.5 | ![]() |
homo | DHINVPSATEKLRW |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |
![]() | C | E | b | 0.0 | ![]() |
homo | VACLIMSPT |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |
![]() | L | E | b | 3.9 | ![]() |
hetero MAP1A_MOUSE homo | LIVFCM |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |
![]() | L | E | b | 9.0 | ![]() |
homo | LFIVAMCD |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |
![]() | S | E | e | 20.3 | ![]() |
hetero CRB_DROME L2GL2_HUMAN E9Q4K7_MOUSE MAP1A_MOUSE compound 5GP GDP G5P 0O2 metal K homo precipitant | DEVHSCIKNR |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |
![]() | L | b | 4.5 | ![]() |
hetero CRB_DROME compound 5GP GDP G5P 0O2 metal UNX homo precipitant | IVLMDN |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
![]() | R | e | 44.3 | ![]() |
hetero CRB_DROME Q9NH88_DROME compound 5GP GDP G5P 0O2 LGP metal UNX homo precipitant | DETANSQVHR |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
![]() | T | G | e | 35.7 | ![]() |
metal UNX homo precipitant | WPVLTIYGACFKM |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |
![]() | Q | G | e | 37.2 | ![]() |
hetero Q9NH88_DROME homo precipitant | QENKHSADFGLRTVY |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |
![]() | S | G | b | 7.0 | ![]() |
compound 5GP GDP G5P 0O2 homo | GADTSKQ |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |
![]() | L | H | b | 3.9 | ![]() |
homo precipitant | AVLIMFTGHR |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |
![]() | K | H | e | 21.7 | ![]() |
homo precipitant | RKQDELANHTFIM |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |
![]() | T | H | e | 36.4 | ![]() |
hetero homo precipitant | QRSVLKANTHIEFG |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |
![]() | L | H | b | 0.0 | ![]() |
homo | LVIKAFMTY |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |
![]() | R | H | b | 10.3 | ![]() |
homo precipitant | RKNQHAGYDEILT |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |
![]() | N | T | e | 69.1 | ![]() |
homo | KYETANSQRDGHIVLM |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |
![]() | S | S | b | 15.6 | ![]() |
homo | KASTLVQIMRGNCFHPYDE |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |
![]() | D | T | e | 61.1 | ![]() |
metal UNX homo | QMFEYDALGHIKNRSVPCT |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |
![]() | L | T | b | 2.2 | ![]() |
homo | PLFIWYADKSEMQRVGNT |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |
![]() | K | b | 17.9 | ![]() |
homo precipitant | DEYKNQGARSFPHVMT |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
![]() | P | b | 0.8 | ![]() |
homo precipitant | PAGVDSKTCELNQW |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
![]() | Y | E | b | 2.2 | ![]() |
homo precipitant | IVYLRKFHATCEMNQS |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |
![]() | I | E | b | 0.6 | ![]() |
metal CL homo precipitant | VSFTYLIAGQEMR |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |
![]() | I | E | b | 0.0 | ![]() |
homo | IVLF |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |
![]() | F | E | b | 4.8 | ![]() |
metal UNX homo | FLYI |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |
![]() | I | E | b | 0.0 | ![]() |
metal UNX homo | ILVFC |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |
![]() | A | E | b | 6.2 | ![]() |
metal UNX homo precipitant | LAKNQRVISTHMCDE |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |
![]() | P | b | 10.1 | ![]() |
metal UNX homo precipitant | PATYE |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
![]() | P | b | 9.3 | ![]() |
homo precipitant | PDKEMTSAGR |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
![]() | S | e | 57.8 | ![]() |
homo precipitant | SDNTCEAIKR |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
![]() | Q | H | e | 32.1 | ![]() |
homo | LKIMRQFWAVENTY |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |
![]() | E | H | e | 38.2 | ![]() |
homo precipitant | EDQAKSTPGHLNRV |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |
![]() | R | H | e | 56.5 | ![]() |
homo precipitant | EADGVKRTHIMNSLPQ |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |
![]() | L | H | b | 4.5 | ![]() |
homo | LVIYMKRT |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |
![]() | R | H | e | 23.3 | ![]() |
compound ADP homo precipitant | ERKQVLADHIMYFNST |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |
![]() | A | H | e | 74.1 | ![]() |
compound GMP G5P homo precipitant | REAKTQNGSDCHLFIV |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |
![]() | L | H | e | 61.2 | ![]() |
compound ADP GMP G5P AGS homo precipitant | RLMIYKPT |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |
![]() | L | e | 72.5 | ![]() |
compound GMP G5P | LIADRSVYEGKMNPQT |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
![]() | A | e | 63.0 | ![]() |
homo precipitant | RIKTAEQSVCHLNDGYFMP |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
![]() | K | H | e | 59.8 | ![]() |
compound GMP homo precipitant | GKRNPESTALQDHCFIVY |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |
![]() | E | H | e | 60.3 | ![]() |
compound ADP GMP AGS homo precipitant | REDAKLQSGHINPTV |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |
![]() | G | e | 33.9 | ![]() |
compound G5P homo precipitant | GSANRDQTEIKLPW |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
![]() | K | T | e | 77.4 | ![]() |
homo precipitant | TQRKLSEADPIMVY |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |
![]() | N | T | e | 90.1 | ![]() |
homo | DENTRSAGFKLQV |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |
![]() | P | e | 116.3 | ![]() |
homo | STPEADLQRFKNVGIMY |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
![]() | K | e | 28.3 | ![]() |
compound 5GP homo precipitant | EDKTARQNSPLMFGHIV |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
![]() | P | H | e | 93.8 | ![]() |
homo precipitant | EDASPTQNILVGKFHMRY |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |
![]() | E | H | e | 34.2 | ![]() |
homo | EVKADRSQTIFGHLMNP |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |
![]() | E | e | 52.8 | ![]() |
hetero VEMP_SARS2 homo precipitant | IESVDQALHRTKGMN |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
![]() | L | H | e | 42.1 | ![]() |
homo precipitant | LAISVEQTFRDKMGN |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |
![]() | R | H | e | 30.8 | ![]() |
homo precipitant | RKQAEINSVFHLDGMPT |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |
![]() | E | H | e | 32.7 | ![]() |
compound 5GP AGS homo precipitant | REKDQAVGSCHILMNT |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |
![]() | I | H | e | 23.4 | ![]() |
homo precipitant | LRIMVTQADFS |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |
![]() | I | H | e | 66.1 | ![]() |
homo precipitant | LIAYVFREMQSDGKNT |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |
![]() | E | H | e | 23.1 | ![]() |
metal UNX homo precipitant | EADKQNLMRSTCGHVY |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |
![]() | K | H | b | 8.0 | ![]() |
compound 5GP homo precipitant | ARKQELSTDGHV |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |
![]() | T | H | e | 27.3 | ![]() |
metal UNX homo precipitant | ASRMTVNYGKQECHIL |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |
![]() | R | H | e | 36.4 | ![]() |
metal UNX homo precipitant | ARKQESNDHGIMVLTWY |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |
![]() | E | H | b | 10.6 | ![]() |
hetero compound 5GP GDP metal UNX homo precipitant | EKRADQFLMVGHIPSTY |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |
![]() | M | H | e | 20.8 | ![]() |
homo | ILMAVEFKYDNTCGHQRS |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |
![]() | E | T | e | 63.8 | ![]() |
homo precipitant | ERQKSADNILMVT |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |
![]() | Q | T | e | 33.2 | ![]() |
homo | QILKSAMRHEVDNCFGTY |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |
![]() | N | G | e | 29.1 | ![]() |
homo precipitant | EASNQHTGKLRDIMVYFW |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |
![]() | N | G | e | 81.8 | ![]() |
metal UNX homo precipitant | YHAFNSDIECKLMVRGPQTW |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |
![]() | G | G | e | 38.1 | ![]() |
homo precipitant | AGSELNPQWHRCFIKMTVDY |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |
![]() | H | e | 63.4 | ![]() |
homo precipitant | HDEGSRPNQAKLYFITV |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
![]() | Y | e | 26.1 | ![]() |
metal UNX CL homo precipitant | YLEKFQADRWHNCGIPSTV |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
![]() | F | S | b | 8.1 | ![]() |
homo precipitant | FYACHIV |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |
![]() | D | S | e | 32.1 | ![]() |
homo precipitant | DTEKNGPQRS |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |
![]() | T | E | e | 27.3 | ![]() |
homo precipitant | YATFHLKVEGRIQ |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |
![]() | A | E | e | 45.5 | ![]() |
homo | VITLAEKQSCNRW |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |
![]() | I | E | b | 4.1 | ![]() |
homo | IVLF |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |
![]() | V | E | e | 58.0 | ![]() |
homo | VILTNQEFSY |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |
![]() | N | b | 10.9 | ![]() |
compound ADP AGS homo | NGAQREHK |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | ||
![]() | S | S | e | 30.5 | ![]() |
compound ADP AGS homo precipitant | DEGSNHAQRTK |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |
![]() | D | S | e | 50.6 | ![]() |
compound ADP AGS homo | DNETSAKVHMQRGL |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |
![]() | L | H | e | 25.3 | ![]() |
compound ADP AGS homo precipitant | LFVINSMPAY |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |
![]() | D | H | e | 56.8 | ![]() |
homo precipitant | DENSQATHKPGV |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |
![]() | K | H | e | 29.7 | ![]() |
homo | ETKRQDSVGNALHIP |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |
![]() | A | H | b | 2.7 | ![]() |
homo | ATSWICV |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |
![]() | Y | H | b | 0.9 | ![]() |
homo | YLVFACIKEHRS |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |
![]() | Q | H | e | 54.6 | ![]() |
homo | AEQSNKGDTRHMFLVY |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |
![]() | E | H | e | 33.7 | ![]() |
homo | EQDKARSHTVILN |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |
![]() | L | H | b | 0.0 | ![]() |
homo | LIVFMTAC |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |
![]() | L | H | b | 6.2 | ![]() |
homo | KLERVQISHACDMNTWY |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |
![]() | R | H | e | 43.1 | ![]() |
homo | SATEKQRDHLNCGV |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |
![]() | L | H | b | 2.8 | ![]() |
homo | ILVATMSFRY |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |
![]() | I | H | b | 1.2 | ![]() |
homo | IVLFMATY |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |
![]() | N | H | e | 36.4 | ![]() |
homo | EQSDNRHTKAGLW |
DOMAIN /note="Guanylate kinase-like" DOMAIN /note="Guanylate kinase-like" | |
![]() | K | T | e | 27.8 | ![]() |
homo | KQRESDHAILNT |
||
![]() | L | T | b | 1.1 | ![]() |
homo precipitant | LQFAIEVNRYP |
||
![]() | D | T | e | 42.6 | ![]() |
metal UNX homo precipitant | QRSDEKCLTPANH |
||
![]() | T | T | e | 79.9 | ![]() |
homo | TGNSLEAKMQRDHIP |
||
![]() | E | S | e | 44.2 | ![]() |
EQTAKDPRSHIY |
|||
![]() | P | e | 30.2 | ![]() |
PKTALGYVFHRE |
||||
![]() | Q | E | b | 14.3 | ![]() |
homo | QIVHLKRYF |
||
![]() | W | E | e | 61.0 | ![]() |
homo | WLS |
||
![]() | V | E | b | 0.7 | ![]() |
VITDGL |
|||
![]() | P | E | b | 7.0 | ![]() |
PR |
|||
![]() | S | G | b | 3.1 | ![]() |
homo | VASIQEY |
||
![]() | T | G | e | 66.2 | ![]() |
SCTGAI |
|||
![]() | W | G | b | 13.5 | ![]() |
WP |
|||
![]() | L | T | e | 41.0 | ![]() |
VLI |
|||
![]() | R | e | 84.2 | ![]() |
RQ |