[All Sites]

Contact Molecules for Homologous Proteins


[Summary Bars]

[Full Bars]


Sites by Variants[40 %]


[Back to Search Page]

[Back to HOMCOS]

[SupCon3D]

[help]
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
15368 468 16 P08887(IL6RA_HUMAN) RecName: Full=Interleukin-6 receptor subunit alpha ; Short=IL-6 receptor subunit alpha; Short=IL-6R subunit alpha; Short=IL-6R-alpha; Short=IL-6RA;AltName: Full=IL-6R 1;AltName: Full=Membrane glycoprotein 80; Short=gp80;AltName: CD_antigen=CD126;Contains: RecName: Full=Soluble interleukin-6 receptor subunit alpha ; Short=sIL6R ;Flags: Precursor;
QUERYSEQ
MLAVGCALLAALLAAPGAALAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLV
RKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQ
GEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSLPVQDSSSVPLPTFLVAGGSLAFGTLLCIAIVLRFKKTWKLRALKEGKTSMHPPYSLGQLVPERPRPTPVLVPLISPPVSPSSLGSDNTSSHNRPDA
RDPRSPYDISNTDYFFPR
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

Statistics of sites in view of Disease classification

All 618944 Hyper-IgE syndrome 5, autosomal recessive, with recurrent infections (HIES5) LB/B (likely benign or benign)
Number of sites 468 2 2
Buired or ExposedBuried 35.1 (%) [105] 50.0 (%) [1]
Exposed 64.9 (%) [194] 50.0 (%) [1]
Ave relacc 33.6 % 25.7 % 0.0 %
SD relacc 27.09 % 25.65 % 0.00 %
Contact Molhetero 14.5 (%) [68] 50.0 (%) [1] 0.0 (%) [0]
nucleotide 0.0 (%) [0] 0.0 (%) [0] 0.0 (%) [0]
compound 5.8 (%) [27] 0.0 (%) [0] 0.0 (%) [0]
metal 0.0 (%) [0] 0.0 (%) [0] 0.0 (%) [0]
otherpoly 3.0 (%) [14] 0.0 (%) [0] 0.0 (%) [0]
homo 7.3 (%) [34] 0.0 (%) [0] 0.0 (%) [0]
precipitant 2.1 (%) [10] 0.0 (%) [0] 0.0 (%) [0]
Number of variants 4 2 2
N_Freq(AAvariant)==0 % 100.0 % [2] 50.0 % [1]
N_Freq(AAvariant)>0 % 0.0 % [0] 50.0 % [1]
Ave Freq(AAvariant) 0.0 % 21.5 %
SD Freq(AAvariant) 0.00 % 21.50 %

Site Table for OMIM:618944 Hyper-IgE syndrome 5, autosomal recessive, with recurrent infections (HIES5) [2 variants]

2 sites 279,280
  [n]:site number of query sequence.  [a]:amino acid of query sequence.  [s]:predicted secondary structure.
  [e]:predicted exposed/buried.  [acc]:predicted relative accesssibility(%).  [pdb]:PDB code of homologous structure.
  [contact_mols]:predicted binding molecules  [observed aa]:Observed amino acids among homologous sequences.  [feature table]:UniProt Feature Table
  [variant]:UniProt Human Variant.
n a s e acc pdb contact_mols observed aa feature table variant
279IEb 0.0 1n26_A
ILVTHCMS
MUTAGEN /note="I->D: Complete loss of ligand-binding." DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" MUTAGEN /note="I->D: Complete loss of ligand-binding." DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" I->N:(0.0 %):LP/P Hyper-IgE syndrome 5, autosomal recessive, with recurrent infections (HIES5) dbSNP:rs1689606 [MIM:618944]
280HSe 51.3 1n26_A hetero IL6RB_HUMAN IL6RB_MOUSE
TLFKHQCRAVNS
MUTAGEN /note="H->I: No change of ligand-binding and no IL6 signaling." DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" MUTAGEN /note="H->I: No change of ligand-binding and no IL6 signaling." DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" H->P:(0.0 %):US Hyper-IgE syndrome 5, autosomal recessive, with recurrent infections (HIES5) [MIM:618944]

Site Table for OMIM:LB/B [2 variants]

2 sites 358,385
  [n]:site number of query sequence.  [a]:amino acid of query sequence.  [s]:predicted secondary structure.
  [e]:predicted exposed/buried.  [acc]:predicted relative accesssibility(%).  [pdb]:PDB code of homologous structure.
  [contact_mols]:predicted binding molecules  [observed aa]:Observed amino acids among homologous sequences.  [feature table]:UniProt Feature Table
  [variant]:UniProt Human Variant.
n a s e acc pdb contact_mols observed aa feature table variant
358D----
DHQEG
TOPO_DOM /note="Extracellular" DISORDER predicted by DISOPRED TOPO_DOM /note="Extracellular" D->A:(0.0 %):LB/B - dbSNP:rs2228145
385V----
IAGV
TRANSMEM /note="Helical" TRANSMEM /note="Helical" V->I:(43.0 %):LB/B - dbSNP:rs2228146