Contact Molecules for Homologous Proteins | ||||
[Summary Bars] |
[Full Bars] |
|
[Back to Search Page] |
[Back to HOMCOS] |
[SupCon3D] |
[help] |
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100] | [show] [download] [help] |
PID | QueryLength | Homolgous Sequence in PDB | UniProt Query | TITLE |
15368 | 468 | 16 | P08887(IL6RA_HUMAN) | RecName: Full=Interleukin-6 receptor subunit alpha ; Short=IL-6 receptor subunit alpha; Short=IL-6R subunit alpha; Short=IL-6R-alpha; Short=IL-6RA;AltName: Full=IL-6R 1;AltName: Full=Membrane glycoprotein 80; Short=gp80;AltName: CD_antigen=CD126;Contains: RecName: Full=Soluble interleukin-6 receptor subunit alpha ; Short=sIL6R ;Flags: Precursor; |
QUERYSEQ |
MLAVGCALLAALLAAPGAALAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLV RKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQ GEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSLPVQDSSSVPLPTFLVAGGSLAFGTLLCIAIVLRFKKTWKLRALKEGKTSMHPPYSLGQLVPERPRPTPVLVPLISPPVSPSSLGSDNTSSHNRPDA RDPRSPYDISNTDYFFPR |
All | 618944 Hyper-IgE syndrome 5, autosomal recessive, with recurrent infections (HIES5) | LB/B (likely benign or benign) | ||
Number of sites | 468 | 2 | 2 | |
Buired or Exposed | Buried | 35.1 (%) [105] | 50.0 (%) [1] | |
Exposed | 64.9 (%) [194] | 50.0 (%) [1] | ||
Ave relacc | 33.6 % | 25.7 % | 0.0 % | |
SD relacc | 27.09 % | 25.65 % | 0.00 % | |
Contact Mol | hetero | 14.5 (%) [68] | 50.0 (%) [1] | 0.0 (%) [0] |
nucleotide | 0.0 (%) [0] | 0.0 (%) [0] | 0.0 (%) [0] | |
compound | 5.8 (%) [27] | 0.0 (%) [0] | 0.0 (%) [0] | |
metal | 0.0 (%) [0] | 0.0 (%) [0] | 0.0 (%) [0] | |
otherpoly | 3.0 (%) [14] | 0.0 (%) [0] | 0.0 (%) [0] | |
homo | 7.3 (%) [34] | 0.0 (%) [0] | 0.0 (%) [0] | |
precipitant | 2.1 (%) [10] | 0.0 (%) [0] | 0.0 (%) [0] | |
Number of variants | 4 | 2 | 2 | |
N_Freq(AAvariant)==0 % | 100.0 % [2] | 50.0 % [1] | ||
N_Freq(AAvariant)>0 % | 0.0 % [0] | 50.0 % [1] | ||
Ave Freq(AAvariant) | 0.0 % | 21.5 % | ||
SD Freq(AAvariant) | 0.00 % | 21.50 % |
2 sites | 279,280 |
[n]:site number of query sequence. [a]:amino acid of query sequence. [s]:predicted secondary structure. [e]:predicted exposed/buried. [acc]:predicted relative accesssibility(%). [pdb]:PDB code of homologous structure. [contact_mols]:predicted binding molecules [observed aa]:Observed amino acids among homologous sequences. [feature table]:UniProt Feature Table [variant]:UniProt Human Variant.
n | a | s | e | acc | pdb | contact_mols | observed aa | feature table | variant |
279 | I | E | b | 0.0 | 1n26_A | ILVTHCMS |
MUTAGEN /note="I->D: Complete loss of ligand-binding." DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" MUTAGEN /note="I->D: Complete loss of ligand-binding." DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" | I->N:(0.0 %):LP/P Hyper-IgE syndrome 5, autosomal recessive, with recurrent infections (HIES5) dbSNP:rs1689606 [MIM:618944] | |
280 | H | S | e | 51.3 | 1n26_A | hetero IL6RB_HUMAN IL6RB_MOUSE | TLFKHQCRAVNS |
MUTAGEN /note="H->I: No change of ligand-binding and no IL6 signaling." DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" MUTAGEN /note="H->I: No change of ligand-binding and no IL6 signaling." DOMAIN /note="Fibronectin type-III 2" TOPO_DOM /note="Extracellular" | H->P:(0.0 %):US Hyper-IgE syndrome 5, autosomal recessive, with recurrent infections (HIES5) [MIM:618944] |
2 sites | 358,385 |
[n]:site number of query sequence. [a]:amino acid of query sequence. [s]:predicted secondary structure. [e]:predicted exposed/buried. [acc]:predicted relative accesssibility(%). [pdb]:PDB code of homologous structure. [contact_mols]:predicted binding molecules [observed aa]:Observed amino acids among homologous sequences. [feature table]:UniProt Feature Table [variant]:UniProt Human Variant.
n | a | s | e | acc | pdb | contact_mols | observed aa | feature table | variant |
358 | D | - | - | - | - | DHQEG |
TOPO_DOM /note="Extracellular" DISORDER predicted by DISOPRED TOPO_DOM /note="Extracellular" | D->A:(0.0 %):LB/B - dbSNP:rs2228145 | |
385 | V | - | - | - | - | IAGV |
TRANSMEM /note="Helical" TRANSMEM /note="Helical" | V->I:(43.0 %):LB/B - dbSNP:rs2228146 |