Contact Molecules for Homologous Proteins | ||||
[Summary Bars] |
[Full Bars] |
|
[Back to Search Page] |
[Back to HOMCOS] |
[SupCon3D] |
[help] |
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100] | [show] [download] [help] |
PID | QueryLength | Homolgous Sequence in PDB | UniProt Query | TITLE |
1166733 | 212 | 22 | P05231(IL6_HUMAN) | RecName: Full=Interleukin-6 ; Short=IL-6;AltName: Full=B-cell stimulatory factor 2; Short=BSF-2;AltName: Full=CTL differentiation factor; Short=CDF;AltName: Full=Hybridoma growth factor;AltName: Full=Interferon beta-2; Short=IFN-beta-2;Flags: Precursor; |
QUERYSEQ |
MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVL IQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM |
All | LB/B (likely benign or benign) | ||
Number of sites | 212 | 2 | |
Buired or Exposed | Buried | 41.5 (%) [71] | 0.0 (%) [0] |
Exposed | 58.5 (%) [100] | 100.0 (%) [1] | |
Ave relacc | 33.5 % | 92.6 % | |
SD relacc | 29.00 % | 0.00 % | |
Contact Mol | hetero | 36.8 (%) [78] | 0.0 (%) [0] |
nucleotide | 13.2 (%) [28] | 0.0 (%) [0] | |
compound | 0.0 (%) [0] | 0.0 (%) [0] | |
metal | 0.0 (%) [0] | 0.0 (%) [0] | |
otherpoly | 0.0 (%) [0] | 0.0 (%) [0] | |
homo | 16.5 (%) [35] | 50.0 (%) [1] | |
precipitant | 8.5 (%) [18] | 0.0 (%) [0] | |
Number of variants | 3 | 3 | |
N_Freq(AAvariant)==0 % | 33.3 % [1] | ||
N_Freq(AAvariant)>0 % | 66.7 % [2] | ||
Ave Freq(AAvariant) | 6.0 % | ||
SD Freq(AAvariant) | 5.35 % |
2 sites | 32,162 |
[n]:site number of query sequence. [a]:amino acid of query sequence. [s]:predicted secondary structure. [e]:predicted exposed/buried. [acc]:predicted relative accesssibility(%). [pdb]:PDB code of homologous structure. [contact_mols]:predicted binding molecules [observed aa]:Observed amino acids among homologous sequences. [feature table]:UniProt Feature Table [variant]:UniProt Human Variant.
n | a | s | e | acc | pdb | contact_mols | observed aa | feature table | variant |
32 | P | - | - | - | - | LRVPQ |
DISORDER predicted by DISOPRED | P->S:(0.0 %):LB/B - dbSNP:rs2069830 | |
162 | D | e | 92.6 | 4cni_C | homo | DGENTVHYS |
D->V:(5.0 %):LB/B - dbSNP:rs2069860;D->E:(13.0 %):LB/B - dbSNP:rs1330643 |