[All Sites]

Contact Molecules for Homologous Proteins


[Summary Bars]

[Full Bars]


Sites by Variants[0 %]


[Back to Search Page]

[Back to HOMCOS]

[SupCon3D]

[help]
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
5461 121 9 P0DTC8(NS8_SARS2) RecName: Full=ORF8 protein; Short=ORF8;AltName: Full=Non-structural protein 8; Short=ns8;Flags: Precursor;
QUERYSEQ
MKFLVFLGIITTVAAFHQECSLQSCTQHQPYVVDDPCPIHFYSKWYIRVGARKSAPLIELCVDEAGSKSPIQYIDIGNYTVSCLPFTINCQEPKLGSLVVRCSFYEDFLEYHDVRVVLDFI
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

Statistics of sites in view of Disease classification

All
Number of sites 121
Buired or ExposedBuried 36.8 (%) [39]
Exposed 63.2 (%) [67]
Ave relacc 38.1 %
SD relacc 28.82 %
Contact Molhetero 21.5 (%) [26]
nucleotide 0.0 (%) [0]
compound 6.6 (%) [8]
metal 14.9 (%) [18]
otherpoly 0.0 (%) [0]
homo 29.8 (%) [36]
precipitant 8.3 (%) [10]
Number of variants 0
N_Freq(AAvariant)==0 %
N_Freq(AAvariant)>0 %
Ave Freq(AAvariant)
SD Freq(AAvariant)