Contact Molecules for Homologous Proteins | ||||
![]() [Summary Bars] |
![]() [Full Bars] |
|
![]() [Back to Search Page] |
![]() [Back to HOMCOS] |
![]() [Sites by Variants] |
![]() [SupCon3D] |
![]() [help] |
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100] | ![]() [show] [download] [help] |
PID | QueryLength | Homolgous Sequence in PDB | UniProt Query | TITLE |
47100 | 154 | 0 | P59633(NS3B_SARS) | RecName: Full=ORF3b protein;AltName: Full=Accessory protein 3b;AltName: Full=Non-structural protein 3b; Short=ns3b;AltName: Full=Protein X2; |
QUERYSEQ |
MMPTTLFAGTHITMTTVYHITVSQIQLSLLKVTAFQHQNSKKTTKLVVILRIGTQVLKTMSLYMAISPKFTTSLSLHKLLQTLVLKMLHSSSLTSLLKTHRMCKYTQSTALQELLIQQWIQFMMSRRRLLACLCKHKKVSTNLCTHSFRK KQVR |
[n]:site number of query sequence. [a]:amino acid of query sequence. [s]:predicted secondary structure. [e]:predicted exposed/buried. [acc]:predicted relative accesssibility(%). [pdb]:PDB code of homologous structure. [contact_mols]:predicted binding molecules [observed aa]:Observed amino acids among homologous sequences. [feature table]:UniProt Feature Table [variant]:UniProt Human Variant.
n | a | s | e | acc | pdb | contact_mols | observed aa | feature table | variant |
![]() | M | - | - | - | - | DISORDER predicted by DISOPRED | |||
![]() | M | - | - | - | - | DISORDER predicted by DISOPRED | |||
![]() | P | - | - | - | - | ||||
![]() | T | - | - | - | - | ||||
![]() | T | - | - | - | - | ||||
![]() | L | - | - | - | - | ||||
![]() | F | - | - | - | - | ||||
![]() | A | - | - | - | - | ||||
![]() | G | - | - | - | - | ||||
![]() | T | - | - | - | - | ||||
![]() | H | - | - | - | - | ||||
![]() | I | - | - | - | - | ||||
![]() | T | - | - | - | - | ||||
![]() | M | - | - | - | - | ||||
![]() | T | - | - | - | - | ||||
![]() | T | - | - | - | - | ||||
![]() | V | - | - | - | - | ||||
![]() | Y | - | - | - | - | ||||
![]() | H | - | - | - | - | ||||
![]() | I | - | - | - | - | ||||
![]() | T | - | - | - | - | ||||
![]() | V | - | - | - | - | ||||
![]() | S | - | - | - | - | ||||
![]() | Q | - | - | - | - | ||||
![]() | I | - | - | - | - | ||||
![]() | Q | - | - | - | - | ||||
![]() | L | - | - | - | - | ||||
![]() | S | - | - | - | - | ||||
![]() | L | - | - | - | - | ||||
![]() | L | - | - | - | - | ||||
![]() | K | - | - | - | - | ||||
![]() | V | - | - | - | - | ||||
![]() | T | - | - | - | - | ||||
![]() | A | - | - | - | - | ||||
![]() | F | - | - | - | - | ||||
![]() | Q | - | - | - | - | ||||
![]() | H | - | - | - | - | ||||
![]() | Q | - | - | - | - | ||||
![]() | N | - | - | - | - | ||||
![]() | S | - | - | - | - | ||||
![]() | K | - | - | - | - | ||||
![]() | K | - | - | - | - | ||||
![]() | T | - | - | - | - | ||||
![]() | T | - | - | - | - | ||||
![]() | K | - | - | - | - | ||||
![]() | L | - | - | - | - | ||||
![]() | V | - | - | - | - | ||||
![]() | V | - | - | - | - | ||||
![]() | I | - | - | - | - | ||||
![]() | L | - | - | - | - | ||||
![]() | R | - | - | - | - | ||||
![]() | I | - | - | - | - | ||||
![]() | G | - | - | - | - | ||||
![]() | T | - | - | - | - | ||||
![]() | Q | - | - | - | - | ||||
![]() | V | - | - | - | - | ||||
![]() | L | - | - | - | - | ||||
![]() | K | - | - | - | - | ||||
![]() | T | - | - | - | - | ||||
![]() | M | - | - | - | - | ||||
![]() | S | - | - | - | - | ||||
![]() | L | - | - | - | - | ||||
![]() | Y | - | - | - | - | ||||
![]() | M | - | - | - | - | ||||
![]() | A | - | - | - | - | ||||
![]() | I | - | - | - | - | ||||
![]() | S | - | - | - | - | ||||
![]() | P | - | - | - | - | ||||
![]() | K | - | - | - | - | ||||
![]() | F | - | - | - | - | ||||
![]() | T | - | - | - | - | ||||
![]() | T | - | - | - | - | ||||
![]() | S | - | - | - | - | ||||
![]() | L | - | - | - | - | ||||
![]() | S | - | - | - | - | ||||
![]() | L | - | - | - | - | ||||
![]() | H | - | - | - | - | ||||
![]() | K | - | - | - | - | ||||
![]() | L | - | - | - | - | ||||
![]() | L | - | - | - | - | REGION /note="Mitochondrial targeting signal" REGION /note="Mitochondrial targeting signal" | |||
![]() | Q | - | - | - | - | REGION /note="Mitochondrial targeting signal" REGION /note="Mitochondrial targeting signal" | |||
![]() | T | - | - | - | - | REGION /note="Mitochondrial targeting signal" REGION /note="Mitochondrial targeting signal" | |||
![]() | L | - | - | - | - | REGION /note="Mitochondrial targeting signal" REGION /note="Mitochondrial targeting signal" | |||
![]() | V | - | - | - | - | REGION /note="Mitochondrial targeting signal" REGION /note="Mitochondrial targeting signal" | |||
![]() | L | - | - | - | - | REGION /note="Mitochondrial targeting signal" REGION /note="Mitochondrial targeting signal" | |||
![]() | K | - | - | - | - | REGION /note="Mitochondrial targeting signal" REGION /note="Mitochondrial targeting signal" | |||
![]() | M | - | - | - | - | REGION /note="Mitochondrial targeting signal" REGION /note="Mitochondrial targeting signal" | |||
![]() | L | - | - | - | - | REGION /note="Mitochondrial targeting signal" REGION /note="Mitochondrial targeting signal" | |||
![]() | H | - | - | - | - | REGION /note="Mitochondrial targeting signal" REGION /note="Mitochondrial targeting signal" | |||
![]() | S | - | - | - | - | REGION /note="Mitochondrial targeting signal" REGION /note="Mitochondrial targeting signal" | |||
![]() | S | - | - | - | - | REGION /note="Mitochondrial targeting signal" REGION /note="Mitochondrial targeting signal" | |||
![]() | S | - | - | - | - | REGION /note="Mitochondrial targeting signal" REGION /note="Mitochondrial targeting signal" | |||
![]() | L | - | - | - | - | REGION /note="Mitochondrial targeting signal" REGION /note="Mitochondrial targeting signal" | |||
![]() | T | - | - | - | - | REGION /note="Mitochondrial targeting signal" REGION /note="Mitochondrial targeting signal" | |||
![]() | S | - | - | - | - | REGION /note="Mitochondrial targeting signal" REGION /note="Mitochondrial targeting signal" | |||
![]() | L | - | - | - | - | REGION /note="Mitochondrial targeting signal" REGION /note="Mitochondrial targeting signal" | |||
![]() | L | - | - | - | - | REGION /note="Mitochondrial targeting signal" REGION /note="Mitochondrial targeting signal" | |||
![]() | K | - | - | - | - | REGION /note="Mitochondrial targeting signal" REGION /note="Mitochondrial targeting signal" | |||
![]() | T | - | - | - | - | REGION /note="Mitochondrial targeting signal" REGION /note="Mitochondrial targeting signal" | |||
![]() | H | - | - | - | - | REGION /note="Mitochondrial targeting signal" REGION /note="Mitochondrial targeting signal" | |||
![]() | R | - | - | - | - | REGION /note="Mitochondrial targeting signal" REGION /note="Mitochondrial targeting signal" | |||
![]() | M | - | - | - | - | REGION /note="Mitochondrial targeting signal" REGION /note="Mitochondrial targeting signal" | |||
![]() | C | - | - | - | - | REGION /note="Mitochondrial targeting signal" REGION /note="Mitochondrial targeting signal" | |||
![]() | K | - | - | - | - | REGION /note="Mitochondrial targeting signal" REGION /note="Mitochondrial targeting signal" | |||
![]() | Y | - | - | - | - | REGION /note="Mitochondrial targeting signal" REGION /note="Mitochondrial targeting signal" | |||
![]() | T | - | - | - | - | REGION /note="Mitochondrial targeting signal" REGION /note="Mitochondrial targeting signal" | |||
![]() | Q | - | - | - | - | REGION /note="Mitochondrial targeting signal" REGION /note="Mitochondrial targeting signal" | |||
![]() | S | - | - | - | - | REGION /note="Mitochondrial targeting signal" REGION /note="Mitochondrial targeting signal" | |||
![]() | T | - | - | - | - | REGION /note="Mitochondrial targeting signal" REGION /note="Mitochondrial targeting signal" | |||
![]() | A | - | - | - | - | REGION /note="Mitochondrial targeting signal" REGION /note="Mitochondrial targeting signal" | |||
![]() | L | - | - | - | - | REGION /note="Mitochondrial targeting signal" REGION /note="Mitochondrial targeting signal" | |||
![]() | Q | - | - | - | - | REGION /note="Mitochondrial targeting signal" REGION /note="Mitochondrial targeting signal" | |||
![]() | E | - | - | - | - | REGION /note="Mitochondrial targeting signal" REGION /note="Mitochondrial targeting signal" | |||
![]() | L | - | - | - | - | REGION /note="Mitochondrial targeting signal" REGION /note="Mitochondrial targeting signal" | |||
![]() | L | - | - | - | - | REGION /note="Mitochondrial targeting signal" REGION /note="Mitochondrial targeting signal" | |||
![]() | I | - | - | - | - | REGION /note="Mitochondrial targeting signal" REGION /note="Mitochondrial targeting signal" | |||
![]() | Q | - | - | - | - | REGION /note="Mitochondrial targeting signal" REGION /note="Mitochondrial targeting signal" | |||
![]() | Q | - | - | - | - | REGION /note="Mitochondrial targeting signal" REGION /note="Mitochondrial targeting signal" | |||
![]() | W | - | - | - | - | REGION /note="Mitochondrial targeting signal" REGION /note="Mitochondrial targeting signal" | |||
![]() | I | - | - | - | - | REGION /note="Mitochondrial targeting signal" REGION /note="Mitochondrial targeting signal" | |||
![]() | Q | - | - | - | - | REGION /note="Mitochondrial targeting signal" REGION /note="Mitochondrial targeting signal" | |||
![]() | F | - | - | - | - | REGION /note="Mitochondrial targeting signal" REGION /note="Mitochondrial targeting signal" | |||
![]() | M | - | - | - | - | REGION /note="Mitochondrial targeting signal" REGION /note="Mitochondrial targeting signal" | |||
![]() | M | - | - | - | - | REGION /note="Mitochondrial targeting signal" REGION /note="Mitochondrial targeting signal" | |||
![]() | S | - | - | - | - | REGION /note="Mitochondrial targeting signal" REGION /note="Mitochondrial targeting signal" | |||
![]() | R | - | - | - | - | REGION /note="Mitochondrial targeting signal" REGION /note="Mitochondrial targeting signal" | |||
![]() | R | - | - | - | - | REGION /note="Mitochondrial targeting signal" REGION /note="Mitochondrial targeting signal" | |||
![]() | R | - | - | - | - | REGION /note="Mitochondrial targeting signal" REGION /note="Mitochondrial targeting signal" | |||
![]() | L | - | - | - | - | REGION /note="Mitochondrial targeting signal" REGION /note="Mitochondrial targeting signal" | |||
![]() | L | - | - | - | - | REGION /note="Mitochondrial targeting signal" REGION /note="Mitochondrial targeting signal" | |||
![]() | A | - | - | - | - | REGION /note="Mitochondrial targeting signal" REGION /note="Mitochondrial targeting signal" | |||
![]() | C | - | - | - | - | REGION /note="Mitochondrial targeting signal" REGION /note="Mitochondrial targeting signal" | |||
![]() | L | - | - | - | - | REGION /note="Mitochondrial targeting signal" REGION /note="Mitochondrial targeting signal" | |||
![]() | C | - | - | - | - | REGION /note="Nucleolar targeting" REGION /note="Mitochondrial targeting signal" REGION /note="Nucleolar targeting" REGION /note="Mitochondrial targeting signal" | |||
![]() | K | - | - | - | - | MOTIF /note="Bipartite nuclear localization signal" REGION /note="Nucleolar targeting" REGION /note="Mitochondrial targeting signal" MOTIF /note="Bipartite nuclear localization signal" REGION /note="Nucleolar targeting" REGION /note="Mitochondrial targeting signal" | |||
![]() | H | - | - | - | - | MOTIF /note="Bipartite nuclear localization signal" REGION /note="Nucleolar targeting" REGION /note="Mitochondrial targeting signal" MOTIF /note="Bipartite nuclear localization signal" REGION /note="Nucleolar targeting" REGION /note="Mitochondrial targeting signal" | |||
![]() | K | - | - | - | - | MOTIF /note="Bipartite nuclear localization signal" REGION /note="Nucleolar targeting" REGION /note="Mitochondrial targeting signal" MOTIF /note="Bipartite nuclear localization signal" REGION /note="Nucleolar targeting" REGION /note="Mitochondrial targeting signal" | |||
![]() | K | - | - | - | - | MOTIF /note="Bipartite nuclear localization signal" REGION /note="Nucleolar targeting" REGION /note="Mitochondrial targeting signal" MOTIF /note="Bipartite nuclear localization signal" REGION /note="Nucleolar targeting" REGION /note="Mitochondrial targeting signal" | |||
![]() | V | - | - | - | - | MOTIF /note="Bipartite nuclear localization signal" REGION /note="Nucleolar targeting" MOTIF /note="Bipartite nuclear localization signal" REGION /note="Nucleolar targeting" | |||
![]() | S | - | - | - | - | MOTIF /note="Bipartite nuclear localization signal" REGION /note="Nucleolar targeting" MOTIF /note="Bipartite nuclear localization signal" REGION /note="Nucleolar targeting" | |||
![]() | T | - | - | - | - | MOTIF /note="Bipartite nuclear localization signal" REGION /note="Nucleolar targeting" MOTIF /note="Bipartite nuclear localization signal" REGION /note="Nucleolar targeting" | |||
![]() | N | - | - | - | - | MOTIF /note="Bipartite nuclear localization signal" REGION /note="Nucleolar targeting" MOTIF /note="Bipartite nuclear localization signal" REGION /note="Nucleolar targeting" | |||
![]() | L | - | - | - | - | MOTIF /note="Bipartite nuclear localization signal" REGION /note="Nucleolar targeting" MOTIF /note="Bipartite nuclear localization signal" REGION /note="Nucleolar targeting" | |||
![]() | C | - | - | - | - | MOTIF /note="Bipartite nuclear localization signal" REGION /note="Nucleolar targeting" MOTIF /note="Bipartite nuclear localization signal" REGION /note="Nucleolar targeting" | |||
![]() | T | - | - | - | - | MOTIF /note="Bipartite nuclear localization signal" REGION /note="Nucleolar targeting" MOTIF /note="Bipartite nuclear localization signal" REGION /note="Nucleolar targeting" | |||
![]() | H | - | - | - | - | MOTIF /note="Bipartite nuclear localization signal" REGION /note="Nucleolar targeting" MOTIF /note="Bipartite nuclear localization signal" REGION /note="Nucleolar targeting" | |||
![]() | S | - | - | - | - | MOTIF /note="Bipartite nuclear localization signal" REGION /note="Nucleolar targeting" MOTIF /note="Bipartite nuclear localization signal" REGION /note="Nucleolar targeting" | |||
![]() | F | - | - | - | - | MOTIF /note="Bipartite nuclear localization signal" REGION /note="Nucleolar targeting" MOTIF /note="Bipartite nuclear localization signal" REGION /note="Nucleolar targeting" | |||
![]() | R | - | - | - | - | MOTIF /note="Bipartite nuclear localization signal" REGION /note="Nucleolar targeting" MOTIF /note="Bipartite nuclear localization signal" REGION /note="Nucleolar targeting" | |||
![]() | K | - | - | - | - | MOTIF /note="Bipartite nuclear localization signal" REGION /note="Nucleolar targeting" MOTIF /note="Bipartite nuclear localization signal" REGION /note="Nucleolar targeting" | |||
![]() | K | - | - | - | - | MOTIF /note="Bipartite nuclear localization signal" REGION /note="Nucleolar targeting" MOTIF /note="Bipartite nuclear localization signal" REGION /note="Nucleolar targeting" | |||
![]() | Q | - | - | - | - | MOTIF /note="Bipartite nuclear localization signal" REGION /note="Nucleolar targeting" MOTIF /note="Bipartite nuclear localization signal" REGION /note="Nucleolar targeting" | |||
![]() | V | - | - | - | - | MOTIF /note="Bipartite nuclear localization signal" REGION /note="Nucleolar targeting" DISORDER predicted by DISOPRED MOTIF /note="Bipartite nuclear localization signal" REGION /note="Nucleolar targeting" | |||
![]() | R | - | - | - | - | REGION /note="Nucleolar targeting" DISORDER predicted by DISOPRED REGION /note="Nucleolar targeting" |