Contact Molecules for Homologous Proteins | ||||
[Summary Bars] |
[Full Bars] |
|
[Back to Search Page] |
[Back to HOMCOS] |
[SupCon3D] |
[help] |
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100] | [show] [download] [help] |
PID | QueryLength | Homolgous Sequence in PDB | UniProt Query | TITLE |
348941 | 198 | 144 | YP_009725304.1() | |
QUERYSEQ |
AIASEFSSLPSYAAFATAQEAYEQAVANGDSEVVLKKLKKSLNVAKSEFDRDAAMQRKLEKMADQAMTQMYKQARSEDKRAKVTSAMQTMLFTMLRKLDNDALNNIINNARDGCVPLNIIPLTTAAKLMVVIPDYNTYKNTCDGTTFTYA SALWEIQQVVDADSKIVQLSEISMDNSPNLAWPLIVTALRANSAVKLQ |
All | ||
Number of sites | 198 | |
Buired or Exposed | Buried | 18.3 (%) [36] |
Exposed | 81.7 (%) [161] | |
Ave relacc | 45.9 % | |
SD relacc | 23.98 % | |
Contact Mol | hetero | 51.0 (%) [101] |
nucleotide | 10.6 (%) [21] | |
compound | 1.5 (%) [3] | |
metal | 0.0 (%) [0] | |
otherpoly | 0.0 (%) [0] | |
homo | 29.3 (%) [58] | |
precipitant | 14.1 (%) [28] | |
Number of variants | 0 | |
N_Freq(AAvariant)==0 % | ||
N_Freq(AAvariant)>0 % | ||
Ave Freq(AAvariant) | ||
SD Freq(AAvariant) |