Contact Molecules for Homologous Proteins | ||||
![]() [Summary Bars] |
![]() [Full Bars] |
|
![]() [Back to Search Page] |
![]() [Back to HOMCOS] |
![]() [Sites by Variants] |
![]() [SupCon3D] |
![]() [help] |
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100] | ![]() [show] [download] [help] |
PID | QueryLength | Homolgous Sequence in PDB | UniProt Query | TITLE |
2748783 | 419 | 189 | P0DTC9(NCAP_SARS2) | RecName: Full=Nucleoprotein ; Short=N;AltName: Full=Nucleocapsid protein ; Short=NC ; Short=Protein N ; |
QUERYSEQ |
MSDNGPQNQRNAPRITFGGPSDSTGSNQNGERSGARSKQRRPQGLPNNTASWFTALTQHGKEDLKFPRGQGVPINTNSSPDDQIGYYRRATRRIRGGDGKMKDLSPRWYFYYLGTGPEAGLPYGANKDGIIWVATEGALNTPKDHIGTRN PANNAAIVLQLPQGTTLPKGFYAEGSRGGSQASSRSSSRSRNSSRNSTPGSSRGTSPARMAGNGGDAALALLLLDRLNQLESKMSGKGQQQQGQTVTKKSAAEASKKPRQKRTATKAYNVTQAFGRRGPEQTQGNFGDQELIRQGTDYKH WPQIAQFAPSASAFFGMSRIGMEVTPSGTWLTYTGAIKLDDKDPNFKDQVILLNKHIDAYKTFPPTEPKKDKKKKADETQALPQRQKKQQTVTLLPAADLDDFSKQLQQSMSSADSTQA |
[n]:site number of query sequence. [a]:amino acid of query sequence. [s]:predicted secondary structure. [e]:predicted exposed/buried. [acc]:predicted relative accesssibility(%). [pdb]:PDB code of homologous structure. [contact_mols]:predicted binding molecules [observed aa]:Observed amino acids among homologous sequences. [feature table]:UniProt Feature Table [variant]:UniProt Human Variant.
n | a | s | e | acc | pdb | contact_mols | observed aa | feature table | variant |
![]() | M | e | 87.4 | ![]() |
M |
COMPBIAS /note="Polar residues" REGION /note="Disordered" COMPBIAS /note="Polar residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | |||
![]() | S | e | 53.1 | ![]() |
S |
COMPBIAS /note="Polar residues" REGION /note="Disordered" COMPBIAS /note="Polar residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | |||
![]() | D | S | e | 39.5 | ![]() |
D |
COMPBIAS /note="Polar residues" REGION /note="Disordered" COMPBIAS /note="Polar residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
![]() | N | S | e | 23.6 | ![]() |
N |
COMPBIAS /note="Polar residues" REGION /note="Disordered" COMPBIAS /note="Polar residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
![]() | G | b | 10.7 | ![]() |
G |
COMPBIAS /note="Polar residues" REGION /note="Disordered" COMPBIAS /note="Polar residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | |||
![]() | P | T | e | 31.8 | ![]() |
P |
COMPBIAS /note="Polar residues" REGION /note="Disordered" COMPBIAS /note="Polar residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
![]() | Q | T | e | 36.7 | ![]() |
Q |
COMPBIAS /note="Polar residues" REGION /note="Disordered" COMPBIAS /note="Polar residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
![]() | N | b | 12.7 | ![]() |
N |
COMPBIAS /note="Polar residues" REGION /note="Disordered" COMPBIAS /note="Polar residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | |||
![]() | Q | T | e | 26.0 | ![]() |
Q |
COMPBIAS /note="Polar residues" REGION /note="Disordered" COMPBIAS /note="Polar residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
![]() | R | T | b | 5.5 | ![]() |
R |
COMPBIAS /note="Polar residues" REGION /note="Disordered" COMPBIAS /note="Polar residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
![]() | N | T | b | 10.3 | ![]() |
NS |
COMPBIAS /note="Polar residues" REGION /note="Disordered" COMPBIAS /note="Polar residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
![]() | A | S | e | 24.1 | ![]() |
AS |
COMPBIAS /note="Polar residues" REGION /note="Disordered" COMPBIAS /note="Polar residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
![]() | P | e | 34.9 | ![]() |
P |
COMPBIAS /note="Polar residues" REGION /note="Disordered" COMPBIAS /note="Polar residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | |||
![]() | R | T | e | 37.2 | ![]() |
RVK |
COMPBIAS /note="Polar residues" REGION /note="Disordered" COMPBIAS /note="Polar residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
![]() | I | T | b | 12.9 | ![]() |
IV |
COMPBIAS /note="Polar residues" REGION /note="Disordered" COMPBIAS /note="Polar residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
![]() | T | S | e | 22.1 | ![]() |
TKS |
COMPBIAS /note="Polar residues" REGION /note="Disordered" COMPBIAS /note="Polar residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
![]() | F | S | e | 65.6 | ![]() |
FL |
COMPBIAS /note="Polar residues" REGION /note="Disordered" COMPBIAS /note="Polar residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
![]() | G | S | e | 83.3 | ![]() |
GKA |
COMPBIAS /note="Polar residues" REGION /note="Disordered" COMPBIAS /note="Polar residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
![]() | G | e | 52.4 | ![]() |
GQD |
COMPBIAS /note="Polar residues" REGION /note="Disordered" COMPBIAS /note="Polar residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | |||
![]() | P | e | 24.8 | ![]() |
PEN |
COMPBIAS /note="Polar residues" REGION /note="Disordered" COMPBIAS /note="Polar residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | |||
![]() | S | S | e | 64.1 | ![]() |
SANTGLDEFHIKMPQRVY |
COMPBIAS /note="Polar residues" REGION /note="Disordered" COMPBIAS /note="Polar residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
![]() | D | S | e | 35.2 | ![]() |
DAGLSEFHIKMNPQRTVY |
COMPBIAS /note="Polar residues" REGION /note="Disordered" COMPBIAS /note="Polar residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
![]() | S | S | e | 101.6 | ![]() |
SQGIALDEFHKMNPRTVY |
COMPBIAS /note="Polar residues" REGION /note="Disordered" COMPBIAS /note="Polar residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
![]() | T | e | 27.3 | ![]() |
TSAGLDEFHIKMNPQRVY |
COMPBIAS /note="Polar residues" REGION /note="Disordered" COMPBIAS /note="Polar residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | |||
![]() | G | S | e | 45.2 | ![]() |
DENGALSFHIKMPQRTVY |
COMPBIAS /note="Polar residues" REGION /note="Disordered" COMPBIAS /note="Polar residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
![]() | S | e | 35.9 | ![]() |
SRTNAGLDEFHIKMPQVY |
COMPBIAS /note="Polar residues" REGION /note="Disordered" COMPBIAS /note="Polar residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | |||
![]() | N | e | 70.3 | ![]() |
NGEALSDFHIKMPQRTVY |
COMPBIAS /note="Polar residues" REGION /note="Disordered" COMPBIAS /note="Polar residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | |||
![]() | Q | T | e | 59.2 | ![]() |
QRLAGSVDEFIKNPTCHMWY |
COMPBIAS /note="Polar residues" REGION /note="Disordered" COMPBIAS /note="Polar residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
![]() | N | T | e | 25.5 | ![]() |
NDALEGIKPRSTVCFHMQY |
COMPBIAS /note="Polar residues" REGION /note="Disordered" COMPBIAS /note="Polar residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
![]() | G | T | e | 60.7 | ![]() |
GNSALDEIKPRTVCFHMQY |
COMPBIAS /note="Polar residues" REGION /note="Disordered" COMPBIAS /note="Polar residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
![]() | E | T | e | 91.5 | ![]() |
GNQEALDIKPRSTVCFHMY |
COMPBIAS /note="Polar residues" REGION /note="Disordered" COMPBIAS /note="Polar residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
![]() | R | e | 57.3 | ![]() |
RNLAGSDEFIKPQTVY |
COMPBIAS /note="Polar residues" REGION /note="Disordered" COMPBIAS /note="Polar residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | |||
![]() | S | e | 84.4 | ![]() |
SRNAGLDEFIKPQTVY |
COMPBIAS /note="Polar residues" REGION /note="Disordered" COMPBIAS /note="Polar residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | |||
![]() | G | e | 81.0 | ![]() |
GRALSDEFIKNPQTVY |
REGION /note="Disordered" DISORDER predicted by DISOPRED REGION /note="Disordered" | |||
![]() | A | e | 79.5 | ![]() |
ARGLSDEFIKNPQTVY |
REGION /note="Disordered" DISORDER predicted by DISOPRED REGION /note="Disordered" | |||
![]() | R | e | 64.8 | ![]() |
RPAGLDEFIKNQSTVY |
REGION /note="Disordered" DISORDER predicted by DISOPRED REGION /note="Disordered" | |||
![]() | S | e | 101.6 | ![]() |
PGNRSALDEFIKQTVY |
REGION /note="Disordered" DISORDER predicted by DISOPRED REGION /note="Disordered" | |||
![]() | K | e | 67.0 | ![]() |
KRQTAGLDEFINPSVY |
REGION /note="Disordered" DISORDER predicted by DISOPRED REGION /note="Disordered" | |||
![]() | Q | e | 34.2 | ![]() |
NQPKAGLDEFIRSTVY |
REGION /note="Disordered" DISORDER predicted by DISOPRED REGION /note="Disordered" | |||
![]() | R | S | e | 53.8 | ![]() |
RPKE |
REGION /note="Disordered" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
![]() | R | S | e | 32.0 | ![]() |
KQRP |
REGION /note="Disordered" REGION /note="RNA-binding" DISORDER predicted by DISOPRED REGION /note="Disordered" REGION /note="RNA-binding" | ||
![]() | P | e | 51.9 | ![]() |
PT |
REGION /note="Disordered" REGION /note="RNA-binding" DISORDER predicted by DISOPRED REGION /note="Disordered" REGION /note="RNA-binding" | |||
![]() | Q | T | e | 58.7 | ![]() |
QKAR |
REGION /note="Disordered" REGION /note="RNA-binding" DISORDER predicted by DISOPRED REGION /note="Disordered" REGION /note="RNA-binding" | ||
![]() | G | T | e | 58.3 | ![]() |
GAVTPELS |
REGION /note="Disordered" REGION /note="RNA-binding" DISORDER predicted by DISOPRED REGION /note="Disordered" REGION /note="RNA-binding" | ||
![]() | L | e | 45.5 | ![]() |
AGNLTESV |
REGION /note="Disordered" REGION /note="RNA-binding" DISORDER predicted by DISOPRED REGION /note="Disordered" REGION /note="RNA-binding" | |||
![]() | P | e | 65.9 | ![]() |
PSQT |
REGION /note="Disordered" REGION /note="RNA-binding" REGION /note="Disordered" REGION /note="RNA-binding" | |||
![]() | N | e | 21.2 | ![]() |
NPSI |
REGION /note="Disordered" REGION /note="RNA-binding" REGION /note="Disordered" REGION /note="RNA-binding" | |||
![]() | N | b | 10.9 | ![]() |
compound DJU U2H | NGPQT |
REGION /note="Disordered" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" REGION /note="Disordered" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | ||
![]() | T | e | 61.0 | ![]() |
nucleotide precipitant | TNHS |
REGION /note="Disordered" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" REGION /note="Disordered" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | ||
![]() | A | e | 57.1 | ![]() |
nucleotide | AVYG |
REGION /note="Disordered" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" REGION /note="Disordered" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | ||
![]() | S | b | 17.2 | ![]() |
S |
REGION /note="Disordered" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" REGION /note="Disordered" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | |||
![]() | W | e | 47.0 | ![]() |
hetero compound DJU U2H metal IOD homo precipitant | W |
DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | ||
![]() | F | b | 15.8 | ![]() |
FY |
DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | |||
![]() | T | b | 1.3 | ![]() |
homo precipitant | QSTA |
DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | ||
![]() | A | e | 20.5 | ![]() |
homo precipitant | GASP |
DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | ||
![]() | L | E | b | 1.1 | ![]() |
hetero homo precipitant | IL |
DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | |
![]() | T | E | b | 6.5 | ![]() |
hetero R1A_SARS2 metal CL homo precipitant | TKV |
DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | |
![]() | Q | b | 4.6 | ![]() |
hetero R1A_SARS2 | QAKE |
DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | ||
![]() | H | S | b | 11.5 | ![]() |
hetero R1A_SARS2 metal ZN CL homo precipitant | FHLTKNADEGIPQRSV |
DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | |
![]() | G | S | e | 33.3 | ![]() |
precipitant | QGNALSDEFIKMPRTVY |
DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | |
![]() | K | e | 92.9 | ![]() |
precipitant | KSAGLV |
DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | ||
![]() | E | e | 57.8 | ![]() |
homo precipitant | KPAELRNQVH |
DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | ||
![]() | D | e | 58.0 | ![]() |
EPDKNQR |
REGION /note="Disordered" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" REGION /note="Disordered" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | |||
![]() | L | b | 5.1 | ![]() |
LFPTIV |
REGION /note="Disordered" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" REGION /note="Disordered" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | |||
![]() | K | e | 63.7 | ![]() |
hetero metal IOD precipitant | KQRAENPGT |
REGION /note="Disordered" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" REGION /note="Disordered" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | ||
![]() | F | b | 18.2 | ![]() |
hetero metal IOD precipitant | FSPTQ |
REGION /note="Disordered" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" REGION /note="Disordered" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | ||
![]() | P | e | 69.8 | ![]() |
hetero metal IOD precipitant | PASVDEFGIKLNQRT |
REGION /note="Disordered" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" REGION /note="Disordered" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | ||
![]() | R | S | e | 73.9 | ![]() |
hetero compound U2H homo precipitant | ERPQDKG |
MUTAGEN /note="R->E: No effect on RNA-binding." REGION /note="Disordered" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" MUTAGEN /note="R->E: No effect on RNA-binding." REGION /note="Disordered" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | |
![]() | G | S | e | 53.6 | ![]() |
hetero homo | G |
REGION /note="Disordered" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" REGION /note="Disordered" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | |
![]() | Q | S | e | 28.6 | ![]() |
hetero | QSE |
REGION /note="Disordered" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" REGION /note="Disordered" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | |
![]() | G | b | 1.2 | ![]() |
G |
REGION /note="Disordered" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" REGION /note="Disordered" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | |||
![]() | V | S | b | 4.7 | ![]() |
precipitant | V |
REGION /note="Disordered" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" REGION /note="Disordered" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | |
![]() | P | b | 0.8 | ![]() |
precipitant | P |
REGION /note="Disordered" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" REGION /note="Disordered" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | ||
![]() | I | e | 35.7 | ![]() |
hetero homo precipitant | IDLTV |
REGION /note="Disordered" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" REGION /note="Disordered" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | ||
![]() | N | b | 4.8 | ![]() |
hetero compound DJU U2H precipitant | NAKS |
REGION /note="Disordered" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" REGION /note="Disordered" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | ||
![]() | T | T | e | 30.5 | ![]() |
hetero homo precipitant | EKNAPIQSTFY |
REGION /note="Disordered" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" REGION /note="Disordered" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | |
![]() | N | T | b | 17.6 | ![]() |
hetero compound DJU U2H metal CL homo precipitant | GNK |
REGION /note="Disordered" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" REGION /note="Disordered" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | |
![]() | S | T | b | 0.8 | ![]() |
hetero metal CL homo precipitant | IVLSNDF |
REGION /note="Disordered" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" REGION /note="Disordered" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | |
![]() | S | b | 13.3 | ![]() |
hetero metal ZN CL homo precipitant | KPTDGS |
REGION /note="Disordered" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" REGION /note="Disordered" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | ||
![]() | P | S | e | 41.9 | ![]() |
hetero homo precipitant | PATSKLGDEFINQRVY |
REGION /note="Disordered" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" REGION /note="Disordered" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | |
![]() | D | S | e | 94.4 | ![]() |
hetero homo | SDTANQG |
REGION /note="Disordered" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" REGION /note="Disordered" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | |
![]() | D | b | 4.3 | ![]() |
hetero metal ZN CL homo | QEYDFK |
REGION /note="Disordered" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" REGION /note="Disordered" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | ||
![]() | Q | b | 1.5 | ![]() |
precipitant | QANEL |
REGION /note="Disordered" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" REGION /note="Disordered" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | ||
![]() | I | b | 8.2 | ![]() |
hetero precipitant | IHKA |
DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | ||
![]() | G | E | b | 0.0 | ![]() |
G |
DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | ||
![]() | Y | E | b | 2.2 | ![]() |
Y |
DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | ||
![]() | Y | E | b | 1.7 | ![]() |
WY |
DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | ||
![]() | R | E | b | 6.7 | ![]() |
hetero R1A_SARS2 nucleotide metal IOD | RNYLKVF |
DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | |
![]() | R | E | e | 48.2 | ![]() |
REKAGLSV |
DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | ||
![]() | A | b | 1.8 | ![]() |
hetero R1A_SARS2 nucleotide | QHVTA |
DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | ||
![]() | T | e | 56.5 | ![]() |
hetero R1A_SARS2 homo | QANTDISL |
DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | ||
![]() | R | S | e | 68.8 | ![]() |
hetero R1A_SARS2 homo precipitant | REHKT |
BINDING /ligand="RNA" /ligand_id="ChEBI:CHEBI:33697" ECO:0007744|PDB:7ACS, ECO:0007744|PDB:7ACT" MUTAGEN /note="R->E: Complete loss of RNA-binding." DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" BINDING /ligand="RNA" /ligand_id="ChEBI:CHEBI:33697" ECO:0007744|PDB:7ACS, ECO:0007744|PDB:7ACT" MUTAGEN /note="R->E: Complete loss of RNA-binding." DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | |
![]() | R | e | 50.6 | ![]() |
nucleotide homo | RKSFYLADEGPTVCHIMNQ |
DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | ||
![]() | I | e | 53.2 | ![]() |
hetero R1A_SARS2 homo | FYIMVWK |
MUTAGEN /note="I->A: Partial loss of RNA-binding." DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" MUTAGEN /note="I->A: Partial loss of RNA-binding." DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | ||
![]() | R | e | 60.1 | ![]() |
hetero R1A_SARS2 nucleotide metal IOD homo | KRNQP |
DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | ||
![]() | G | S | e | 34.5 | ![]() |
hetero R1A_SARS2 precipitant | TPMGRKSI |
DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | |
![]() | G | e | 25.0 | ![]() |
hetero R1A_SARS2 homo precipitant | GVPARSK |
DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | ||
![]() | D | e | 28.4 | ![]() |
homo precipitant | KDRNESAGL |
DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | ||
![]() | G | S | e | 84.5 | ![]() |
GKAELSV |
DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | ||
![]() | K | S | e | 86.8 | ![]() |
QGKRNPADEILSTV |
DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | ||
![]() | M | G | e | 60.9 | ![]() |
homo | RQIVMTH |
DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | |
![]() | K | G | e | 99.1 | ![]() |
homo precipitant | KVREP |
DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | |
![]() | D | G | e | 66.7 | ![]() |
homo | QPDELNS |
DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | |
![]() | L | S | b | 1.1 | ![]() |
hetero R1A_SARS2 homo | LVAP |
DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | |
![]() | S | b | 8.6 | ![]() |
hetero R1A_SARS2 homo | PLASN |
DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | ||
![]() | P | e | 22.5 | ![]() |
hetero R1A_SARS2 | PDESAGLV |
DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | ||
![]() | R | E | b | 19.4 | ![]() |
hetero R1A_SARS2 nucleotide homo precipitant | RAKN |
BINDING /ligand="RNA" /ligand_id="ChEBI:CHEBI:33697" ECO:0007744|PDB:7ACS, ECO:0007744|PDB:7ACT" MUTAGEN /note="R->E: Complete loss of RNA-binding." DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" BINDING /ligand="RNA" /ligand_id="ChEBI:CHEBI:33697" ECO:0007744|PDB:7ACS, ECO:0007744|PDB:7ACT" MUTAGEN /note="R->E: Complete loss of RNA-binding." DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | |
![]() | W | E | b | 1.6 | ![]() |
WLV |
DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | ||
![]() | Y | E | e | 28.7 | ![]() |
hetero R1A_SARS2 nucleotide precipitant | YFH |
MUTAGEN /note="Y->A: Significant decrease of RNA binding capacity." DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" MUTAGEN /note="Y->A: Significant decrease of RNA binding capacity." DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | |
![]() | F | E | b | 4.3 | ![]() |
F |
DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | ||
![]() | Y | E | b | 2.2 | ![]() |
nucleotide metal IOD | Y |
DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | |
![]() | Y | E | b | 4.3 | ![]() |
YF |
DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | ||
![]() | L | T | b | 3.4 | ![]() |
hetero | LT |
DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | |
![]() | G | T | b | 0.0 | ![]() |
hetero homo | G |
DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | |
![]() | T | b | 9.1 | ![]() |
homo | T |
DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | ||
![]() | G | S | b | 2.4 | ![]() |
homo precipitant | G |
DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | |
![]() | P | S | e | 25.6 | ![]() |
hetero nucleotide homo precipitant | PR |
DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | |
![]() | E | T | e | 61.8 | ![]() |
homo | HAEFY |
DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | |
![]() | A | T | e | 74.1 | ![]() |
hetero homo | AGKS |
DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | |
![]() | G | b | 15.5 | ![]() |
hetero homo | DGNKSA |
DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | ||
![]() | L | e | 34.8 | ![]() |
hetero homo | LADSH |
DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | ||
![]() | P | S | e | 33.3 | ![]() |
hetero homo precipitant | KNPRQEST |
DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | |
![]() | Y | S | e | 39.6 | ![]() |
hetero precipitant | FYW |
DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | |
![]() | G | S | b | 1.2 | ![]() |
hetero compound DJU U2H | GRK |
DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | |
![]() | A | e | 21.4 | ![]() |
hetero metal CL homo | DTEQASKY |
DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | ||
![]() | N | S | e | 85.5 | ![]() |
hetero metal CL homo precipitant | SKRDNVAT |
DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | |
![]() | K | S | e | 76.4 | ![]() |
precipitant | QIKLNTVSH |
DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | |
![]() | D | S | e | 23.5 | ![]() |
precipitant | DEPA |
DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | |
![]() | G | E | e | 39.3 | ![]() |
GD |
DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | ||
![]() | I | E | b | 11.7 | ![]() |
VI |
DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | ||
![]() | I | e | 26.9 | ![]() |
precipitant | VFIC |
DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | ||
![]() | W | e | 48.2 | ![]() |
precipitant | W |
DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | ||
![]() | V | b | 19.3 | ![]() |
V |
DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | |||
![]() | A | b | 17.9 | ![]() |
hetero | AGHKYS |
DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | ||
![]() | T | e | 25.3 | ![]() |
hetero precipitant | AKSNEQRTIVG |
DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | ||
![]() | E | T | e | 56.8 | ![]() |
hetero homo | KEDNQHGS |
DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | |
![]() | G | T | e | 79.8 | ![]() |
hetero homo | GQD |
DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | |
![]() | A | b | 4.5 | ![]() |
hetero | AS |
DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | ||
![]() | L | e | 37.6 | ![]() |
hetero precipitant | DMKTVLNIE |
DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | ||
![]() | N | b | 7.9 | ![]() |
hetero precipitant | TNVDIS |
DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | ||
![]() | T | b | 19.5 | ![]() |
hetero precipitant | KTEANSQR |
DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | ||
![]() | P | e | 32.6 | ![]() |
hetero | PSTRFKI |
DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | ||
![]() | K | e | 40.6 | ![]() |
TRSAKLIP |
DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | |||
![]() | D | S | e | 22.8 | ![]() |
hetero metal CL homo | STDGANELV |
DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | |
![]() | H | T | e | 32.5 | ![]() |
hetero metal ZN CL homo | NDVHGYTLAEIKPRSCFMQ |
DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | |
![]() | I | T | b | 9.4 | ![]() |
hetero compound DJU U2H metal ZN CL homo precipitant | LIQFVMY |
DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | |
![]() | G | T | b | 13.1 | ![]() |
homo | GVSLA |
DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | |
![]() | T | S | b | 11.0 | ![]() |
homo | TVESDNA |
DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | |
![]() | R | e | 39.5 | ![]() |
hetero homo | R |
BINDING /ligand="RNA" /ligand_id="ChEBI:CHEBI:33697" ECO:0007744|PDB:7ACS, ECO:0007744|PDB:7ACT" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" BINDING /ligand="RNA" /ligand_id="ChEBI:CHEBI:33697" ECO:0007744|PDB:7ACS, ECO:0007744|PDB:7ACT" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | ||
![]() | N | e | 36.4 | ![]() |
hetero compound DJU U2H metal IOD homo | DGNKR |
DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | ||
![]() | P | T | e | 105.4 | ![]() |
hetero nucleotide homo precipitant | PSAKLDEFGINQRTVY |
DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | |
![]() | A | T | e | 60.7 | ![]() |
hetero nucleotide compound DJU homo precipitant | SDATN |
DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | |
![]() | N | S | e | 26.1 | ![]() |
hetero metal IOD homo precipitant | NKSEIT |
DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | |
![]() | N | e | 47.3 | ![]() |
hetero metal IOD homo precipitant | NFDHEKQ |
DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | ||
![]() | A | S | e | 33.0 | ![]() |
hetero homo precipitant | EDPAGVS |
DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | |
![]() | A | b | 2.7 | ![]() |
homo | AQSEI |
DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | ||
![]() | I | b | 2.3 | ![]() |
hetero precipitant | IYKA |
DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | ||
![]() | V | b | 4.0 | ![]() |
homo | PVA |
DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | ||
![]() | L | b | 0.6 | ![]() |
hetero homo | LTVHEC |
DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | ||
![]() | Q | b | 0.5 | ![]() |
hetero homo | RKQEP |
DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | ||
![]() | L | b | 4.5 | ![]() |
hetero homo | FLIT |
DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | ||
![]() | P | b | 13.2 | ![]() |
hetero precipitant | APSVTGLDEIKNRCFHMQY |
DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | ||
![]() | Q | S | b | 2.6 | ![]() |
hetero homo | PEDNGQALIKRSTVCFHMY |
MUTAGEN /note="Q->A: Partial loss of RNA-binding." DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" MUTAGEN /note="Q->A: Partial loss of RNA-binding." DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | |
![]() | G | S | b | 3.6 | ![]() |
hetero homo | GDPAEFIKLNQRSTVY |
DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | |
![]() | T | S | e | 22.7 | ![]() |
hetero homo | TGVNALDEFIKPQRSY |
DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | |
![]() | T | e | 21.4 | ![]() |
hetero homo | KTVPILFAEGSCDHMNQRY |
DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | ||
![]() | L | b | 8.4 | ![]() |
hetero homo | LVINPDAGSEFKQRTY |
DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | ||
![]() | P | e | 42.6 | ![]() |
hetero metal IOD homo | PNGALSDEFIKQRTVY |
REGION /note="Disordered" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" REGION /note="Disordered" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | ||
![]() | K | T | e | 67.0 | ![]() |
hetero metal IOD homo precipitant | QKSGADPNLEFIRTVY |
REGION /note="Disordered" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" REGION /note="Disordered" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | |
![]() | G | T | e | 40.5 | ![]() |
hetero homo | GENSRQFALDIKPTVY |
REGION /note="Disordered" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" REGION /note="Disordered" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | |
![]() | F | b | 3.8 | ![]() |
hetero homo | FYRNVADEGIKLPQST |
REGION /note="Disordered" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" REGION /note="Disordered" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | ||
![]() | Y | B | b | 2.2 | ![]() |
hetero R1A_SARS2 homo precipitant | YQHAENFWDGIKLPRSTV |
MUTAGEN /note="Y->A: Partial loss of RNA-binding." REGION /note="Disordered" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" MUTAGEN /note="Y->A: Partial loss of RNA-binding." REGION /note="Disordered" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | |
![]() | A | b | 8.0 | ![]() |
hetero R1A_SARS2 homo | LIVAERNSDFGKPQTY |
REGION /note="Disordered" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" REGION /note="Disordered" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | ||
![]() | E | b | 1.5 | ![]() |
homo | EPRSWFADGIKLNQTVY |
MUTAGEN /note="E->R: Significant increase of RNA-binding." REGION /note="Disordered" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" MUTAGEN /note="E->R: Significant increase of RNA-binding." REGION /note="Disordered" DOMAIN /note="CoV N NTD" ECO:0000269|PubMed:32363136" REGION /note="RNA-binding" | ||
![]() | G | b | 6.0 | ![]() |
GDVRSIALEFKNPQTY |
REGION /note="Disordered" REGION /note="RNA-binding" REGION /note="Disordered" REGION /note="RNA-binding" | |||
![]() | S | b | 13.3 | ![]() |
SNRTPFAEGKLV |
MOD_RES /note="Phosphoserine; by host" REGION /note="SR region" REGION /note="Disordered" REGION /note="RNA-binding" MOD_RES /note="Phosphoserine; by host" REGION /note="SR region" REGION /note="Disordered" REGION /note="RNA-binding" | |||
![]() | R | e | 25.3 | ![]() |
GRDSQILAEFKNPTVY |
REGION /note="SR region" COMPBIAS /note="Polar residues" REGION /note="Disordered" REGION /note="RNA-binding" REGION /note="SR region" COMPBIAS /note="Polar residues" DISORDER predicted by DISOPRED REGION /note="Disordered" REGION /note="RNA-binding" | |||
![]() | G | T | e | 84.5 | ![]() |
GRSALNDEFIKPQTVY |
REGION /note="SR region" COMPBIAS /note="Polar residues" REGION /note="Disordered" REGION /note="RNA-binding" REGION /note="SR region" COMPBIAS /note="Polar residues" DISORDER predicted by DISOPRED REGION /note="Disordered" REGION /note="RNA-binding" | ||
![]() | G | T | e | 98.8 | ![]() |
GRNSQLTVADEIKP |
REGION /note="SR region" COMPBIAS /note="Polar residues" REGION /note="Disordered" REGION /note="RNA-binding" REGION /note="SR region" COMPBIAS /note="Polar residues" DISORDER predicted by DISOPRED REGION /note="Disordered" REGION /note="RNA-binding" | ||
![]() | S | T | e | 28.1 | ![]() |
SGPANFDREKLTV |
REGION /note="SR region" COMPBIAS /note="Polar residues" REGION /note="Disordered" REGION /note="RNA-binding" REGION /note="SR region" COMPBIAS /note="Polar residues" DISORDER predicted by DISOPRED REGION /note="Disordered" REGION /note="RNA-binding" | ||
![]() | Q | b | 6.6 | ![]() |
QRNDAPSL |
REGION /note="SR region" COMPBIAS /note="Polar residues" REGION /note="Disordered" REGION /note="RNA-binding" REGION /note="SR region" COMPBIAS /note="Polar residues" DISORDER predicted by DISOPRED REGION /note="Disordered" REGION /note="RNA-binding" | |||
![]() | A | e | 68.8 | ![]() |
SGAVWNPR |
REGION /note="SR region" COMPBIAS /note="Polar residues" REGION /note="Disordered" REGION /note="RNA-binding" REGION /note="SR region" COMPBIAS /note="Polar residues" DISORDER predicted by DISOPRED REGION /note="Disordered" REGION /note="RNA-binding" | |||
![]() | S | S | e | 46.9 | ![]() |
NSRQDGPA |
REGION /note="SR region" COMPBIAS /note="Polar residues" REGION /note="Disordered" REGION /note="RNA-binding" REGION /note="SR region" COMPBIAS /note="Polar residues" DISORDER predicted by DISOPRED REGION /note="Disordered" REGION /note="RNA-binding" | ||
![]() | S | S | b | 13.3 | ![]() |
SFRNQD |
REGION /note="SR region" COMPBIAS /note="Polar residues" REGION /note="Disordered" REGION /note="RNA-binding" REGION /note="SR region" COMPBIAS /note="Polar residues" DISORDER predicted by DISOPRED REGION /note="Disordered" REGION /note="RNA-binding" | ||
![]() | R | e | 56.5 | ![]() |
RSIN |
REGION /note="SR region" COMPBIAS /note="Polar residues" REGION /note="Disordered" REGION /note="RNA-binding" REGION /note="SR region" COMPBIAS /note="Polar residues" DISORDER predicted by DISOPRED REGION /note="Disordered" REGION /note="RNA-binding" | |||
![]() | S | e | 27.3 | ![]() |
SGARWPNT |
REGION /note="SR region" COMPBIAS /note="Polar residues" REGION /note="Disordered" REGION /note="RNA-binding" REGION /note="SR region" COMPBIAS /note="Polar residues" DISORDER predicted by DISOPRED REGION /note="Disordered" REGION /note="RNA-binding" | |||
![]() | S | b | 9.4 | ![]() |
SDRGQLNAT |
REGION /note="SR region" COMPBIAS /note="Polar residues" REGION /note="Disordered" REGION /note="SR region" COMPBIAS /note="Polar residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | |||
![]() | S | T | b | 8.6 | ![]() |
SNFRGAT |
MUTAGEN /note="S->A: No effect on phosphorylation." REGION /note="SR region" COMPBIAS /note="Polar residues" REGION /note="Disordered" MUTAGEN /note="S->A: No effect on phosphorylation." REGION /note="SR region" COMPBIAS /note="Polar residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
![]() | R | T | e | 41.1 | ![]() |
RSIEKPQTNV |
REGION /note="SR region" COMPBIAS /note="Polar residues" REGION /note="Disordered" REGION /note="SR region" COMPBIAS /note="Polar residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
![]() | S | S | e | 35.9 | ![]() |
SPRQGA |
REGION /note="SR region" COMPBIAS /note="Polar residues" REGION /note="Disordered" REGION /note="SR region" COMPBIAS /note="Polar residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
![]() | R | e | 36.4 | ![]() |
RSQLAKNIP |
REGION /note="SR region" COMPBIAS /note="Polar residues" REGION /note="Disordered" REGION /note="SR region" COMPBIAS /note="Polar residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | |||
![]() | N | e | 24.8 | ![]() |
NSRAPEGQH |
REGION /note="SR region" COMPBIAS /note="Polar residues" REGION /note="Disordered" REGION /note="SR region" COMPBIAS /note="Polar residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | |||
![]() | S | S | e | 84.4 | ![]() |
RSQGNV |
REGION /note="SR region" COMPBIAS /note="Polar residues" REGION /note="Disordered" REGION /note="SR region" COMPBIAS /note="Polar residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
![]() | S | e | 45.3 | ![]() |
SGPQRNK |
REGION /note="SR region" COMPBIAS /note="Polar residues" REGION /note="Disordered" REGION /note="SR region" COMPBIAS /note="Polar residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | |||
![]() | R | S | e | 82.2 | ![]() |
RNSPAGQ |
REGION /note="SR region" COMPBIAS /note="Polar residues" REGION /note="Disordered" REGION /note="SR region" COMPBIAS /note="Polar residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
![]() | N | S | b | 9.7 | ![]() |
NSRAGTP |
REGION /note="SR region" COMPBIAS /note="Polar residues" REGION /note="Disordered" REGION /note="SR region" COMPBIAS /note="Polar residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
![]() | S | b | 14.8 | ![]() |
RSGNQPAKL |
REGION /note="SR region" COMPBIAS /note="Polar residues" REGION /note="Disordered" REGION /note="SR region" COMPBIAS /note="Polar residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | |||
![]() | T | b | 1.3 | ![]() |
SRATKNL |
REGION /note="SR region" COMPBIAS /note="Polar residues" REGION /note="Disordered" REGION /note="SR region" COMPBIAS /note="Polar residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | |||
![]() | P | b | 2.3 | ![]() |
RSPGQADELV |
REGION /note="SR region" COMPBIAS /note="Polar residues" REGION /note="Disordered" REGION /note="SR region" COMPBIAS /note="Polar residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | |||
![]() | G | b | 4.8 | ![]() |
SGTRDAE |
REGION /note="SR region" COMPBIAS /note="Polar residues" REGION /note="Disordered" REGION /note="SR region" COMPBIAS /note="Polar residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | |||
![]() | S | b | 10.2 | ![]() |
SNAQLRVG |
REGION /note="SR region" COMPBIAS /note="Polar residues" REGION /note="Disordered" REGION /note="SR region" COMPBIAS /note="Polar residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | |||
![]() | S | S | e | 66.4 | ![]() |
SADRNTVGL |
REGION /note="SR region" COMPBIAS /note="Polar residues" REGION /note="Disordered" REGION /note="SR region" COMPBIAS /note="Polar residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
![]() | R | S | e | 53.0 | ![]() |
RSN |
MUTAGEN /note="R->M: No effect on virus replication ex vivo." MUTAGEN /note="RG->KR: Partial increase of pathogenesis and fitness in vivo. No effect on virus replication ex vivo." REGION /note="SR region" COMPBIAS /note="Polar residues" REGION /note="Disordered" MUTAGEN /note="R->M: No effect on virus replication ex vivo." MUTAGEN /note="RG->KR: Partial increase of pathogenesis and fitness in vivo. No effect on virus replication ex vivo." REGION /note="SR region" COMPBIAS /note="Polar residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
![]() | G | b | 9.5 | ![]() |
GSQNAT |
MUTAGEN /note="RG->KR: Partial increase of pathogenesis and fitness in vivo. No effect on virus replication ex vivo." REGION /note="SR region" COMPBIAS /note="Polar residues" REGION /note="Disordered" MUTAGEN /note="RG->KR: Partial increase of pathogenesis and fitness in vivo. No effect on virus replication ex vivo." REGION /note="SR region" COMPBIAS /note="Polar residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | |||
![]() | T | e | 63.6 | ![]() |
RNASTHVL |
REGION /note="SR region" COMPBIAS /note="Polar residues" REGION /note="Disordered" REGION /note="SR region" COMPBIAS /note="Polar residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | |||
![]() | S | b | 10.9 | ![]() |
SAQNRHETDGIKLPV |
MOD_RES /note="Phosphoserine; by host GSK3-alpha and GSK3-beta" MUTAGEN /note="S->A: Partial loss of phosphorylation." REGION /note="SR region" COMPBIAS /note="Polar residues" REGION /note="Disordered" MOD_RES /note="Phosphoserine; by host GSK3-alpha and GSK3-beta" MUTAGEN /note="S->A: Partial loss of phosphorylation." REGION /note="SR region" COMPBIAS /note="Polar residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | |||
![]() | P | S | e | 72.1 | ![]() |
PSGNQRHADEIKLTV |
COMPBIAS /note="Polar residues" REGION /note="Disordered" COMPBIAS /note="Polar residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
![]() | A | e | 48.2 | ![]() |
SAGNQRFVTDEIKLP |
COMPBIAS /note="Polar residues" REGION /note="Disordered" COMPBIAS /note="Polar residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | |||
![]() | R | S | e | 54.9 | ![]() |
RSQDNGKV |
REGION /note="Disordered" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
![]() | M | S | e | 22.7 | ![]() |
TAPQHMDGEIRNVKL |
REGION /note="Disordered" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
![]() | A | S | b | 9.8 | ![]() |
ASPVGDIQFL |
REGION /note="Disordered" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
![]() | G | S | b | 2.4 | ![]() |
SNKDGAMTPVEILQR |
REGION /note="Disordered" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
![]() | N | S | e | 49.7 | ![]() |
NRPDSQKGVHAL |
DISORDER predicted by DISOPRED | ||
![]() | G | S | b | 14.3 | ![]() |
GDEKSALPNVT |
DISORDER predicted by DISOPRED | ||
![]() | G | T | e | 25.0 | ![]() |
GVKMRSIAEDPLT |
DISORDER predicted by DISOPRED | ||
![]() | D | T | e | 47.5 | ![]() |
DASETVRQ |
DISORDER predicted by DISOPRED | ||
![]() | A | T | b | 3.6 | ![]() |
ADRESTMLP |
DISORDER predicted by DISOPRED | ||
![]() | A | T | b | 3.6 | ![]() |
AGSLEIPRTVD |
|||
![]() | L | T | b | 14.0 | ![]() |
IVLRAWSTYM |
|||
![]() | A | H | b | 0.0 | ![]() |
AKERLDM |
|||
![]() | L | H | b | 6.7 | ![]() |
SADQLKPIVR |
|||
![]() | L | H | b | 5.6 | ![]() |
LADGIVYPQ |
|||
![]() | L | H | b | 11.2 | ![]() |
VLAGMISK |
|||
![]() | L | H | b | 0.0 | ![]() |
LAEQVFIKG |
|||
![]() | D | H | b | 16.7 | ![]() |
DAEQKLS |
|||
![]() | R | H | b | 5.9 | ![]() |
KDRALVEGTS |
|||
![]() | L | H | b | 0.0 | ![]() |
LPKVAIEQGS |
|||
![]() | N | H | b | 12.1 | ![]() |
GKAIDNQELFPRSTVY |
|||
![]() | Q | H | e | 24.0 | ![]() |
KARVQEDSTNLFGIPY |
DISORDER predicted by DISOPRED | ||
![]() | L | H | b | 1.1 | ![]() |
LRKDGITEQAFNPSVY |
DISORDER predicted by DISOPRED | ||
![]() | E | H | b | 1.5 | ![]() |
AEDKQILGPRSTVCFHMNY |
DISORDER predicted by DISOPRED | ||
![]() | S | H | b | 10.9 | ![]() |
ASGKTQDRELVCFHIMNPY |
DISORDER predicted by DISOPRED | ||
![]() | K | H | e | 42.5 | ![]() |
KQLVGSADEFINPRTY |
COMPBIAS /note="Polar residues" REGION /note="Disordered" COMPBIAS /note="Polar residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
![]() | M | b | 11.6 | ![]() |
RDIVPESGLMAFHKNQTY |
COMPBIAS /note="Polar residues" REGION /note="Disordered" COMPBIAS /note="Polar residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | |||
![]() | S | b | 14.1 | ![]() |
ASIDLEGKPRTVCFHMNQY |
COMPBIAS /note="Polar residues" REGION /note="Disordered" COMPBIAS /note="Polar residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | |||
![]() | G | b | 19.0 | ![]() |
GKRTDLAESVFINPQCHMWY |
COMPBIAS /note="Polar residues" REGION /note="Disordered" COMPBIAS /note="Polar residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | |||
![]() | K | T | e | 98.6 | ![]() |
QKSELTVRADFGINPY |
COMPBIAS /note="Polar residues" REGION /note="Disordered" COMPBIAS /note="Polar residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
![]() | G | T | e | 90.5 | ![]() |
GDPKNSVAEFILQRT |
COMPBIAS /note="Polar residues" REGION /note="Disordered" COMPBIAS /note="Polar residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
![]() | Q | b | 15.3 | ![]() |
QKSPATNL |
COMPBIAS /note="Polar residues" REGION /note="Disordered" COMPBIAS /note="Polar residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | |||
![]() | Q | S | e | 102.0 | ![]() |
QKDTERSPL |
COMPBIAS /note="Polar residues" REGION /note="Disordered" COMPBIAS /note="Polar residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
![]() | Q | e | 60.7 | ![]() |
KQESRTADFGILNPVY |
COMPBIAS /note="Polar residues" REGION /note="Disordered" COMPBIAS /note="Polar residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | |||
![]() | Q | b | 11.2 | ![]() |
KRQSNHPADEFGILTVY |
COMPBIAS /note="Polar residues" REGION /note="Disordered" COMPBIAS /note="Polar residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | |||
![]() | G | b | 13.1 | ![]() |
GPSAQLDEFIKNRTVY |
COMPBIAS /note="Polar residues" REGION /note="Disordered" COMPBIAS /note="Polar residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | |||
![]() | Q | b | 13.3 | ![]() |
SKQNVDAREGILPT |
COMPBIAS /note="Polar residues" REGION /note="Disordered" COMPBIAS /note="Polar residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | |||
![]() | T | e | 83.1 | ![]() |
RSQNVTADEGIKLP |
COMPBIAS /note="Polar residues" REGION /note="Disordered" COMPBIAS /note="Polar residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | |||
![]() | V | b | 18.0 | ![]() |
VIKTLAS |
COMPBIAS /note="Polar residues" REGION /note="Disordered" COMPBIAS /note="Polar residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | |||
![]() | T | e | 42.9 | ![]() |
TPSACR |
COMPBIAS /note="Polar residues" REGION /note="Disordered" DOMAIN /note="CoV N CTD" COMPBIAS /note="Polar residues" DISORDER predicted by DISOPRED REGION /note="Disordered" DOMAIN /note="CoV N CTD" | |||
![]() | K | S | e | 70.8 | ![]() |
KRS |
COMPBIAS /note="Polar residues" REGION /note="Disordered" DOMAIN /note="CoV N CTD" COMPBIAS /note="Polar residues" DISORDER predicted by DISOPRED REGION /note="Disordered" DOMAIN /note="CoV N CTD" | ||
![]() | K | e | 81.1 | ![]() |
QKADNSEV |
COMPBIAS /note="Polar residues" REGION /note="Disordered" DOMAIN /note="CoV N CTD" COMPBIAS /note="Polar residues" DISORDER predicted by DISOPRED REGION /note="Disordered" DOMAIN /note="CoV N CTD" | |||
![]() | S | e | 33.6 | ![]() |
KSTNDQER |
COMPBIAS /note="Polar residues" REGION /note="Disordered" DOMAIN /note="CoV N CTD" COMPBIAS /note="Polar residues" DISORDER predicted by DISOPRED REGION /note="Disordered" DOMAIN /note="CoV N CTD" | |||
![]() | A | S | e | 100.0 | ![]() |
ASTK |
COMPBIAS /note="Polar residues" REGION /note="Disordered" DOMAIN /note="CoV N CTD" COMPBIAS /note="Polar residues" DISORDER predicted by DISOPRED REGION /note="Disordered" DOMAIN /note="CoV N CTD" | ||
![]() | A | S | e | 36.6 | ![]() |
KADPSNEQ |
REGION /note="Disordered" DOMAIN /note="CoV N CTD" DISORDER predicted by DISOPRED REGION /note="Disordered" DOMAIN /note="CoV N CTD" | ||
![]() | E | G | e | 57.8 | ![]() |
EAKRS |
REGION /note="Disordered" DOMAIN /note="CoV N CTD" DISORDER predicted by DISOPRED REGION /note="Disordered" DOMAIN /note="CoV N CTD" | ||
![]() | A | G | b | 12.5 | ![]() |
AMNVITSK |
REGION /note="Disordered" DOMAIN /note="CoV N CTD" DISORDER predicted by DISOPRED REGION /note="Disordered" DOMAIN /note="CoV N CTD" | ||
![]() | S | G | b | 10.9 | ![]() |
compound GTP | ARKETNS |
REGION /note="Disordered" DOMAIN /note="CoV N CTD" DISORDER predicted by DISOPRED REGION /note="Disordered" DOMAIN /note="CoV N CTD" | |
![]() | K | G | e | 29.7 | ![]() |
metal CL precipitant | HQNESKDR |
MOTIF /note="Nuclear localization signal" REGION /note="Disordered" DOMAIN /note="CoV N CTD" MOTIF /note="Nuclear localization signal" DISORDER predicted by DISOPRED REGION /note="Disordered" DOMAIN /note="CoV N CTD" | |
![]() | K | S | e | 33.0 | ![]() |
metal CL precipitant | KR |
MOTIF /note="Nuclear localization signal" REGION /note="Disordered" DOMAIN /note="CoV N CTD" MOTIF /note="Nuclear localization signal" DISORDER predicted by DISOPRED REGION /note="Disordered" DOMAIN /note="CoV N CTD" | |
![]() | P | b | 5.4 | ![]() |
homo precipitant | PRHMLTK |
MOTIF /note="Nuclear localization signal" REGION /note="Disordered" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" MOTIF /note="Nuclear localization signal" REGION /note="Disordered" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | ||
![]() | R | G | b | 5.1 | ![]() |
compound GTP 5GP GUN GMP metal CL homo precipitant | RYTE |
MOTIF /note="Nuclear localization signal" REGION /note="Disordered" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" MOTIF /note="Nuclear localization signal" REGION /note="Disordered" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | |
![]() | Q | G | e | 27.6 | ![]() |
homo precipitant | WQCHD |
MOTIF /note="Nuclear localization signal" REGION /note="Disordered" REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" MOTIF /note="Nuclear localization signal" REGION /note="Disordered" REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | |
![]() | K | G | e | 60.4 | ![]() |
homo precipitant | KR |
MOTIF /note="Nuclear localization signal" REGION /note="Disordered" REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" MOTIF /note="Nuclear localization signal" REGION /note="Disordered" REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | |
![]() | R | b | 6.3 | ![]() |
compound GTP metal CL homo precipitant | RK |
MOTIF /note="Nuclear localization signal" REGION /note="Disordered" REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" MOTIF /note="Nuclear localization signal" REGION /note="Disordered" REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | ||
![]() | T | e | 60.4 | ![]() |
metal CL K homo precipitant | TSQVIA |
MOTIF /note="Nuclear localization signal" REGION /note="Disordered" REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" MOTIF /note="Nuclear localization signal" REGION /note="Disordered" REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | ||
![]() | A | b | 6.2 | ![]() |
homo precipitant | PAISV |
MOTIF /note="Nuclear localization signal" REGION /note="Disordered" REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" MOTIF /note="Nuclear localization signal" REGION /note="Disordered" REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | ||
![]() | T | B | e | 42.2 | ![]() |
NPGTHKSA |
REGION /note="Disordered" REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Disordered" REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | ||
![]() | K | T | e | 70.8 | ![]() |
metal CL precipitant | KPGD |
REGION /note="Disordered" REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Disordered" REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | |
![]() | A | T | e | 79.5 | ![]() |
GQDENSAFH |
REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | ||
![]() | Y | B | b | 2.6 | ![]() |
metal CL precipitant | YCFVENSKLADGIPQRT |
REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | |
![]() | N | e | 29.1 | ![]() |
compound GKP metal CL | NDKPSTRG |
REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | ||
![]() | V | H | b | 3.3 | ![]() |
homo precipitant | VIM |
REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | |
![]() | T | H | b | 17.5 | ![]() |
compound GKP metal K homo | TDQEVA |
REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | |
![]() | Q | H | b | 19.4 | ![]() |
metal CL homo | QVKRAET |
REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | |
![]() | A | H | b | 2.7 | ![]() |
homo | CVFAN |
REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | |
![]() | F | S | e | 20.6 | ![]() |
homo precipitant | FY |
REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | |
![]() | G | b | 14.3 | ![]() |
metal CL homo precipitant | GL |
REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | ||
![]() | R | S | b | 18.2 | ![]() |
compound GKP metal K CL homo precipitant | PKARLQM |
REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | |
![]() | R | b | 9.9 | ![]() |
compound GKP metal K homo precipitant | RL |
REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | ||
![]() | G | S | e | 25.0 | ![]() |
homo | GSTR |
REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | |
![]() | P | S | e | 92.2 | ![]() |
hetero homo | PGKTALSDEINQRVCFHMY |
REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | |
![]() | E | e | 28.1 | ![]() |
hetero homo | KGNREFTLSADIPQVY |
REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | ||
![]() | Q | S | e | 43.4 | ![]() |
hetero homo precipitant | QGDPKRCLAEFINSTVY |
REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | |
![]() | T | S | b | 3.9 | ![]() |
hetero compound GTP 5GP GUN GMP homo precipitant | LKSATDEGIPRVCFHMNQY |
REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | |
![]() | Q | S | b | 3.6 | ![]() |
homo | ESQDPALGIKRTVCFHMNY |
REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | |
![]() | G | b | 10.7 | ![]() |
homo | GAHSLDEIKNPQRTVCFMY |
REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | ||
![]() | N | S | e | 38.8 | ![]() |
homo | N |
REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | |
![]() | F | B | b | 11.5 | ![]() |
homo precipitant | F |
REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | |
![]() | G | b | 0.0 | ![]() |
G |
REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | |||
![]() | D | b | 3.7 | ![]() |
precipitant | DGSN |
REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | ||
![]() | Q | H | b | 2.0 | ![]() |
compound GKP precipitant | SDAGMQRPLT |
REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | |
![]() | E | H | b | 11.6 | ![]() |
precipitant | EKDGQN |
REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | |
![]() | L | H | b | 1.7 | ![]() |
precipitant | MLFVY |
REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | |
![]() | I | H | b | 15.2 | ![]() |
compound GKP | VNLI |
REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | |
![]() | R | H | b | 17.4 | ![]() |
metal CL precipitant | KAER |
REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | |
![]() | Q | H | e | 26.0 | ![]() |
metal CL precipitant | LNEKQF |
REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | |
![]() | G | e | 21.4 | ![]() |
precipitant | G |
REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | ||
![]() | T | T | b | 4.5 | ![]() |
metal CL homo precipitant | TIVNS |
REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | |
![]() | D | T | e | 40.7 | ![]() |
precipitant | KSDNEGAT |
REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | |
![]() | Y | b | 1.7 | ![]() |
precipitant | DAY |
REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | ||
![]() | K | T | e | 53.3 | ![]() |
metal CL precipitant | PKGS |
REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | |
![]() | H | T | b | 11.0 | ![]() |
metal CL precipitant | RQHGC |
REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | |
![]() | W | H | b | 14.3 | ![]() |
metal CL homo precipitant | YFVWL |
REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | |
![]() | P | H | e | 65.9 | ![]() |
metal NA | PTA |
REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | |
![]() | Q | H | e | 25.0 | ![]() |
metal K NA CL precipitant | QAI |
REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | |
![]() | I | H | b | 0.6 | ![]() |
homo | LMIAFT |
REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | |
![]() | A | T | e | 21.4 | ![]() |
metal MG homo | AL |
REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | |
![]() | Q | T | e | 54.6 | ![]() |
metal MG homo precipitant | ENSQ |
REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | |
![]() | F | S | b | 0.5 | ![]() |
homo precipitant | LCFM |
REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | |
![]() | A | S | e | 46.4 | ![]() |
metal MG homo precipitant | VAI |
REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | |
![]() | P | e | 20.9 | ![]() |
homo precipitant | P |
REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | ||
![]() | S | e | 60.9 | ![]() |
metal K CL homo precipitant | STNG |
REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | ||
![]() | A | H | e | 39.3 | ![]() |
metal CL K homo precipitant | AVSPT |
REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | |
![]() | S | H | e | 89.1 | ![]() |
metal K homo precipitant | SHGA |
REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | |
![]() | A | H | e | 39.3 | ![]() |
homo | AS |
REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | |
![]() | F | H | b | 5.7 | ![]() |
homo | FCILM |
REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | |
![]() | F | T | e | 78.9 | ![]() |
homo precipitant | LFMI |
REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | |
![]() | G | T | e | 54.8 | ![]() |
homo precipitant | FGSL |
REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | |
![]() | M | T | e | 30.0 | ![]() |
compound GTP 5GP GUN GMP homo | GMDTA |
REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | |
![]() | S | S | b | 10.2 | ![]() |
homo | SG |
REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | |
![]() | R | e | 67.2 | ![]() |
hetero homo | RHKQNYM |
REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | ||
![]() | I | e | 44.4 | ![]() |
hetero homo | VLWIF |
REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | ||
![]() | G | E | e | 38.1 | ![]() |
hetero homo precipitant | TEAKSVGD |
REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | |
![]() | M | E | e | 44.0 | ![]() |
hetero homo precipitant | LPASTVM |
REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | |
![]() | E | E | e | 44.2 | ![]() |
hetero metal K precipitant | KERTVA |
REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | |
![]() | V | e | 84.0 | ![]() |
metal K homo precipitant | ELPDKHVN |
REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | ||
![]() | T | e | 21.4 | ![]() |
hetero precipitant | QDTSELMAGKRV |
REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | ||
![]() | P | T | e | 41.9 | ![]() |
hetero | PGKADNESQL |
REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | |
![]() | S | T | b | 7.0 | ![]() |
hetero homo | DSNP |
REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | |
![]() | G | S | e | 44.0 | ![]() |
homo | GQVDTASE |
REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | |
![]() | T | S | e | 33.1 | ![]() |
homo | YLIVTAN |
REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | |
![]() | W | E | b | 6.0 | ![]() |
hetero compound GTP 5GP GUN GMP metal CL homo precipitant | EHFWVK |
REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | |
![]() | L | E | b | 6.2 | ![]() |
homo | LVI |
REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | |
![]() | T | E | b | 16.9 | ![]() |
hetero homo precipitant | TRKQHSL |
REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | |
![]() | Y | b | 16.1 | ![]() |
hetero homo | YFLI |
REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | ||
![]() | T | e | 47.4 | ![]() |
hetero homo | TSENKH |
REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | ||
![]() | G | e | 50.0 | ![]() |
hetero homo precipitant | GFHYT |
REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | ||
![]() | A | e | 32.1 | ![]() |
hetero compound GTP 5GP homo precipitant | AKTRSE |
REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | ||
![]() | I | e | 21.6 | ![]() |
compound GTP 5GP GMP homo | ITYVM |
REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | ||
![]() | K | e | 68.4 | ![]() |
compound GTP 5GP GUN GMP homo | VRKHTLY |
REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | ||
![]() | L | e | 37.6 | ![]() |
homo | VLF |
REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | ||
![]() | D | e | 56.2 | ![]() |
homo precipitant | PDSK |
REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Putative NLRP3 binding" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | ||
![]() | D | T | e | 69.1 | ![]() |
homo | KRSPDAC |
REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | |
![]() | K | T | e | 83.5 | ![]() |
homo precipitant | DTKSEN |
REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | |
![]() | D | S | e | 35.8 | ![]() |
homo precipitant | DLNHT |
REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | |
![]() | P | T | e | 85.3 | ![]() |
PSK |
REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | ||
![]() | N | T | e | 53.3 | ![]() |
precipitant | QNGHAEKLSTV |
REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | |
![]() | F | H | b | 16.7 | ![]() |
homo | FYLADEGIKNPQRSTV |
REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | |
![]() | K | H | e | 56.6 | ![]() |
homo | EDKNLAGIPSTV |
REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | |
![]() | D | H | e | 21.0 | ![]() |
metal K NA precipitant | TNKDEQAFGILPRSV |
REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | |
![]() | Q | H | b | 4.6 | ![]() |
metal K NA precipitant | YIWQEKNADGLPRSTV |
REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | |
![]() | V | H | b | 14.7 | ![]() |
metal NA homo | VMTLQSADEGIKPR |
REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | |
![]() | I | H | b | 16.4 | ![]() |
KEFIGSTADLPRV |
REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | ||
![]() | L | H | b | 1.7 | ![]() |
precipitant | ILVQ |
REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | |
![]() | L | H | b | 19.1 | ![]() |
homo | LCFADEGIKNPRSTV |
REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | |
![]() | N | H | e | 24.8 | ![]() |
metal NA homo precipitant | DNELVAKRTGIPS |
REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | |
![]() | K | H | e | 24.1 | ![]() |
metal CL precipitant | QEASK |
REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | |
![]() | H | H | b | 2.1 | ![]() |
NCQH |
REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | ||
![]() | I | B | e | 39.2 | ![]() |
homo precipitant | VIL |
REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | |
![]() | D | T | e | 35.2 | ![]() |
homo precipitant | DN |
REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | |
![]() | A | G | b | 4.5 | ![]() |
precipitant | AG |
REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | |
![]() | Y | G | b | 3.5 | ![]() |
homo | YVFI |
REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | |
![]() | K | G | e | 43.9 | ![]() |
homo | KGQAV |
REGION /note="Disordered" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" REGION /note="Disordered" REGION /note="Dimerization" DOMAIN /note="CoV N CTD" | |
![]() | T | G | b | 9.1 | ![]() |
homo precipitant | TRLDNSCIAEFGKPQV |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" DOMAIN /note="CoV N CTD" COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" DOMAIN /note="CoV N CTD" | |
![]() | F | S | b | 6.7 | ![]() |
compound GKP homo | RFGALSDEIKNPQTVCHMWY |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" DOMAIN /note="CoV N CTD" COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" DOMAIN /note="CoV N CTD" | |
![]() | P | T | e | 43.4 | ![]() |
compound GKP homo | PDAGLEKSTVFINQRYCHMW |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" DOMAIN /note="CoV N CTD" COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" DOMAIN /note="CoV N CTD" | |
![]() | P | T | e | 50.4 | ![]() |
PKAGLSDEINQRTVCFHMY |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" | ||
![]() | T | T | e | 26.6 | ![]() |
STDKLAEGIPRVCFHMNQY |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" | ||
![]() | E | S | e | 25.6 | ![]() |
EDPRLAGIKSTVCFHMNQY |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" | ||
![]() | P | S | e | 106.2 | ![]() |
PVEQAGLDFIKNRSTY |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" COMPBIAS /note="Basic and acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
![]() | K | e | 65.1 | ![]() |
KARPTGLSDEFIMNQVY |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" COMPBIAS /note="Basic and acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | |||
![]() | K | e | 74.5 | ![]() |
KPQSDAEGLTV |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" COMPBIAS /note="Basic and acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | |||
![]() | D | e | 35.8 | ![]() |
EDNPVRAGKLST |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" COMPBIAS /note="Basic and acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | |||
![]() | K | e | 57.1 | ![]() |
QKRSE |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" COMPBIAS /note="Basic and acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | |||
![]() | K | b | 9.9 | ![]() |
RKSDNPQA |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" COMPBIAS /note="Basic and acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | |||
![]() | K | T | e | 83.5 | ![]() |
KQGRSAPTD |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" COMPBIAS /note="Basic and acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
![]() | K | T | e | 88.7 | ![]() |
RKGDAP |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" COMPBIAS /note="Basic and acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
![]() | A | e | 41.1 | ![]() |
KASGTR |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" COMPBIAS /note="Basic and acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | |||
![]() | D | e | 100.0 | ![]() |
DSTK |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" COMPBIAS /note="Basic and acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | |||
![]() | E | e | 56.3 | ![]() |
RDEVSN |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" COMPBIAS /note="Basic and acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | |||
![]() | T | e | 46.8 | ![]() |
SVARDLMT |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" COMPBIAS /note="Basic and acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | |||
![]() | Q | e | 84.7 | ![]() |
SKQNAG |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" COMPBIAS /note="Basic and acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | |||
![]() | A | e | 42.9 | ![]() |
SPAT |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" COMPBIAS /note="Basic and acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | |||
![]() | L | S | e | 76.4 | ![]() |
AKLRVEGS |
COMPBIAS /note="Basic and acidic residues" REGION /note="Disordered" COMPBIAS /note="Basic and acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
![]() | P | S | e | 26.4 | ![]() |
PEAL |
REGION /note="Disordered" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
![]() | Q | e | 65.3 | ![]() |
QARDGL |
REGION /note="Disordered" DISORDER predicted by DISOPRED REGION /note="Disordered" | |||
![]() | R | e | 32.4 | ![]() |
RTSKAGL |
REGION /note="Disordered" DISORDER predicted by DISOPRED REGION /note="Disordered" | |||
![]() | Q | S | e | 31.6 | ![]() |
KQEPS |
REGION /note="Disordered" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
![]() | K | e | 32.1 | ![]() |
RKQPG |
REGION /note="Disordered" DISORDER predicted by DISOPRED REGION /note="Disordered" | |||
![]() | K | S | e | 94.3 | ![]() |
EGQKMRS |
REGION /note="Disordered" DISORDER predicted by DISOPRED REGION /note="Disordered" | ||
![]() | Q | e | 63.8 | ![]() |
QERADFGIKLNPSTV |
REGION /note="Disordered" DISORDER predicted by DISOPRED REGION /note="Disordered" | |||
![]() | Q | b | 16.3 | ![]() |
QRDLPAEFGIKNSTV |
REGION /note="Disordered" DISORDER predicted by DISOPRED REGION /note="Disordered" | |||
![]() | T | e | 53.2 | ![]() |
TQVSDLAEFGIKNPRY |
REGION /note="Disordered" DISORDER predicted by DISOPRED REGION /note="Disordered" | |||
![]() | V | S | e | 44.0 | ![]() |
VPLADEFGIKNQRSTY |
DISORDER predicted by DISOPRED | ||
![]() | T | T | e | 36.4 | ![]() |
TAELDGKPSVCFHIMNQRY |
|||
![]() | L | T | e | 92.1 | ![]() |
LVQADEGIKPRST |
|||
![]() | L | b | 9.0 | ![]() |
VLKP |
||||
![]() | P | e | 43.4 | ![]() |
PKE |
||||
![]() | A | T | b | 9.8 | ![]() |
ADN |
|||
![]() | A | T | b | 5.4 | ![]() |
ADS |
|||
![]() | D | H | b | 16.7 | ![]() |
LDE |
SITE /note="Cleavage (by host CASP6)" SITE /note="Cleavage (by host CASP6)" | ||
![]() | L | H | b | 1.7 | ![]() |
IVLM |
SITE /note="Cleavage (by host CASP6)" REGION /note="Tetramerization" SITE /note="Cleavage (by host CASP6)" REGION /note="Tetramerization" | ||
![]() | D | H | b | 1.9 | ![]() |
DE |
SITE /note="Cleavage (by host CASP6)" REGION /note="Tetramerization" SITE /note="Cleavage (by host CASP6)" REGION /note="Tetramerization" | ||
![]() | D | H | b | 16.0 | ![]() |
ND |
SITE /note="Cleavage (by host CASP6)" REGION /note="Tetramerization" SITE /note="Cleavage (by host CASP6)" REGION /note="Tetramerization" | ||
![]() | F | H | e | 25.8 | ![]() |
YFV |
REGION /note="Tetramerization" REGION /note="Tetramerization" | ||
![]() | S | H | b | 13.3 | ![]() |
ST |
REGION /note="Tetramerization" REGION /note="Tetramerization" | ||
![]() | K | H | b | 5.7 | ![]() |
KR |
REGION /note="Tetramerization" REGION /note="Tetramerization" | ||
![]() | Q | H | b | 19.4 | ![]() |
Q |
REGION /note="Tetramerization" REGION /note="Tetramerization" | ||
![]() | L | H | e | 42.7 | ![]() |
L |
REGION /note="Tetramerization" REGION /note="Tetramerization" | ||
![]() | Q | H | e | 41.3 | ![]() |
Q |
REGION /note="Tetramerization" REGION /note="Tetramerization" | ||
![]() | Q | H | e | 23.5 | ![]() |
NQ |
REGION /note="Tetramerization" DISORDER predicted by DISOPRED REGION /note="Tetramerization" | ||
![]() | S | H | e | 48.4 | ![]() |
S |
REGION /note="Tetramerization" DISORDER predicted by DISOPRED REGION /note="Tetramerization" | ||
![]() | M | H | e | 51.2 | ![]() |
M |
REGION /note="Tetramerization" DISORDER predicted by DISOPRED REGION /note="Tetramerization" | ||
![]() | S | H | b | 17.2 | ![]() |
S |
REGION /note="Tetramerization" DISORDER predicted by DISOPRED REGION /note="Tetramerization" | ||
![]() | S | H | e | 39.1 | ![]() |
S |
REGION /note="Tetramerization" DISORDER predicted by DISOPRED REGION /note="Tetramerization" | ||
![]() | A | H | e | 70.5 | ![]() |
A |
REGION /note="Tetramerization" DISORDER predicted by DISOPRED REGION /note="Tetramerization" | ||
![]() | D | H | e | 87.7 | ![]() |
D |
REGION /note="Tetramerization" DISORDER predicted by DISOPRED REGION /note="Tetramerization" | ||
![]() | S | S | e | 47.7 | ![]() |
S |
REGION /note="Tetramerization" DISORDER predicted by DISOPRED REGION /note="Tetramerization" | ||
![]() | T | S | e | 83.1 | ![]() |
T |
REGION /note="Tetramerization" DISORDER predicted by DISOPRED REGION /note="Tetramerization" | ||
![]() | Q | e | 61.7 | ![]() |
Q |
REGION /note="Tetramerization" DISORDER predicted by DISOPRED REGION /note="Tetramerization" | |||
![]() | A | b | 13.4 | ![]() |
A |
REGION /note="Tetramerization" DISORDER predicted by DISOPRED REGION /note="Tetramerization" |