Contact Molecules for Homologous Proteins
[Summary Bars]	[Full Bars]	Site Table[90 %]	[Back to Search Page]	[Back to HOMCOS]
[Sites by Variants]	[SupCon3D]	[help]	seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]	[show] [download] [help]

PID	QueryLength	Homolgous Sequence in PDB	UniProt Query	TITLE
2727836	179	7	Q13241(KLRD1_HUMAN)	RecName: Full=Natural killer cells antigen CD94;AltName: Full=KP43;AltName: Full=Killer cell lectin-like receptor subfamily D member 1;AltName: Full=NK cell receptor;AltName: CD_antigen=CD94 ;
QUERYSEQ	MAVFKTTLWRLISGTLGIICLSLMSTLGILLKNSFTKLSIEPAFTPGPNIELQKDSDCCSCQEKWVGYRCNCYFISSEQKTWNESRHLCASQKSSLLQLQNTDELDFMSSSQQFYWIGLSYSEEHTAWLWENGSALSQYLFPSFETFNTK NCIAYNPNGNALDESCEDKNRYICKQQLI

  [n]:site number of query sequence.  [a]:amino acid of query sequence.  [s]:predicted secondary structure.
  [e]:predicted exposed/buried.  [acc]:predicted relative accesssibility(%).  [pdb]:PDB code of homologous structure.
  [contact_mols]:predicted binding molecules  [observed aa]:Observed amino acids among homologous sequences.  [feature table]:UniProt Feature Table
  [variant]:UniProt Human Variant.

n	a	s	e	acc	pdb	contact_mols	observed aa	feature table	variant
1	M	-	-	-	-		M	TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic"
2	A	-	-	-	-		AS	TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic"
3	V	-	-	-	-		VAI	TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic"
4	F	-	-	-	-		FSLK	TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic"
5	K	-	-	-	-		KQREA	TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic"
6	T	-	-	-	-		TSDALI	TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic"
7	T	-	-	-	-		TVKLA	TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic"
8	L	-	-	-	-		LTVIRA	TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED
9	W	-	-	-	-		WTA	TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED
10	R	-	-	-	-		RHKQMSN	TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED
11	L	-	-	-	-		LMRVFIS	TRANSMEM /note="Helical; Signal-anchor for type II membrane protein" TRANSMEM /note="Helical; Signal-anchor for type II membrane protein" DISORDER predicted by DISOPRED
12	I	-	-	-	-		ILVTMQ	TRANSMEM /note="Helical; Signal-anchor for type II membrane protein" TRANSMEM /note="Helical; Signal-anchor for type II membrane protein" DISORDER predicted by DISOPRED
13	S	-	-	-	-		ASTIVLP	TRANSMEM /note="Helical; Signal-anchor for type II membrane protein" TRANSMEM /note="Helical; Signal-anchor for type II membrane protein" DISORDER predicted by DISOPRED
14	G	-	-	-	-		GVSKLECIMA	TRANSMEM /note="Helical; Signal-anchor for type II membrane protein" TRANSMEM /note="Helical; Signal-anchor for type II membrane protein" DISORDER predicted by DISOPRED
15	T	-	-	-	-		VIAKTGFCMP	TRANSMEM /note="Helical; Signal-anchor for type II membrane protein" TRANSMEM /note="Helical; Signal-anchor for type II membrane protein" DISORDER predicted by DISOPRED
16	L	-	-	-	-		LIMFGSVW	TRANSMEM /note="Helical; Signal-anchor for type II membrane protein" TRANSMEM /note="Helical; Signal-anchor for type II membrane protein" DISORDER predicted by DISOPRED
17	G	-	-	-	-		GAISFT	TRANSMEM /note="Helical; Signal-anchor for type II membrane protein" TRANSMEM /note="Helical; Signal-anchor for type II membrane protein" DISORDER predicted by DISOPRED
18	I	-	-	-	-		IVCATKL	TRANSMEM /note="Helical; Signal-anchor for type II membrane protein" TRANSMEM /note="Helical; Signal-anchor for type II membrane protein" DISORDER predicted by DISOPRED
19	I	-	-	-	-		ILVAKMFRS	TRANSMEM /note="Helical; Signal-anchor for type II membrane protein" TRANSMEM /note="Helical; Signal-anchor for type II membrane protein" DISORDER predicted by DISOPRED
20	C	-	-	-	-		CLVIAGSF	TRANSMEM /note="Helical; Signal-anchor for type II membrane protein" TRANSMEM /note="Helical; Signal-anchor for type II membrane protein" DISORDER predicted by DISOPRED
21	L	-	-	-	-		LVIFACT	TRANSMEM /note="Helical; Signal-anchor for type II membrane protein" TRANSMEM /note="Helical; Signal-anchor for type II membrane protein" DISORDER predicted by DISOPRED
22	S	-	-	-	-		VILSKARFGQM	TRANSMEM /note="Helical; Signal-anchor for type II membrane protein" TRANSMEM /note="Helical; Signal-anchor for type II membrane protein" DISORDER predicted by DISOPRED
23	L	-	-	-	-		LIVMT	TRANSMEM /note="Helical; Signal-anchor for type II membrane protein" TRANSMEM /note="Helical; Signal-anchor for type II membrane protein" DISORDER predicted by DISOPRED
24	M	-	-	-	-		MLVIFYCR	TRANSMEM /note="Helical; Signal-anchor for type II membrane protein" TRANSMEM /note="Helical; Signal-anchor for type II membrane protein" DISORDER predicted by DISOPRED
25	S	-	-	-	-		VASTFGICKM	TRANSMEM /note="Helical; Signal-anchor for type II membrane protein" TRANSMEM /note="Helical; Signal-anchor for type II membrane protein" DISORDER predicted by DISOPRED	S->A:(20.0 %):LB/B - dbSNP:rs1077225
26	T	-	-	-	-		TVIGNSAKLMYC	TRANSMEM /note="Helical; Signal-anchor for type II membrane protein" TRANSMEM /note="Helical; Signal-anchor for type II membrane protein" DISORDER predicted by DISOPRED
27	L	-	-	-	-		VLMTSIAYW	TRANSMEM /note="Helical; Signal-anchor for type II membrane protein" TRANSMEM /note="Helical; Signal-anchor for type II membrane protein" DISORDER predicted by DISOPRED
28	G	-	-	-	-		GSVANFIMKLP	TRANSMEM /note="Helical; Signal-anchor for type II membrane protein" TRANSMEM /note="Helical; Signal-anchor for type II membrane protein" DISORDER predicted by DISOPRED
29	I	-	-	-	-		VIFATLMS	TRANSMEM /note="Helical; Signal-anchor for type II membrane protein" TRANSMEM /note="Helical; Signal-anchor for type II membrane protein"
30	L	-	-	-	-		LIVMGAKW	TRANSMEM /note="Helical; Signal-anchor for type II membrane protein" TRANSMEM /note="Helical; Signal-anchor for type II membrane protein"
31	L	-	-	-	-		LVMIAFQRCTE	TRANSMEM /note="Helical; Signal-anchor for type II membrane protein" TRANSMEM /note="Helical; Signal-anchor for type II membrane protein"
32	K	-	-	-	-		KPVQRGNSTLACEIW	TOPO_DOM /note="Extracellular" TOPO_DOM /note="Extracellular"
33	N	-	-	-	-		NLSKVHADEFIQRTG	TOPO_DOM /note="Extracellular" TOPO_DOM /note="Extracellular"
34	S	-	-	-	-		SLTAEGHNICFVWP	TOPO_DOM /note="Extracellular" DISORDER predicted by DISOPRED TOPO_DOM /note="Extracellular"
35	F	-	-	-	-		FVILHAYCRSDT	TOPO_DOM /note="Extracellular" TOPO_DOM /note="Extracellular"
36	T	-	-	-	-		TSAVQELGNIFDPY	TOPO_DOM /note="Extracellular" TOPO_DOM /note="Extracellular"
37	K	-	-	-	-		KVQRTACIELGPSN	TOPO_DOM /note="Extracellular" TOPO_DOM /note="Extracellular"
38	L	-	-	-	-		LVPISEQCGRTFNK	TOPO_DOM /note="Extracellular" TOPO_DOM /note="Extracellular"
39	S	-	-	-	-		SANELCPQRKTWGHV	TOPO_DOM /note="Extracellular" TOPO_DOM /note="Extracellular"
40	I	-	-	-	-		LIVTFMERQSKAGNP	TOPO_DOM /note="Extracellular" TOPO_DOM /note="Extracellular"
41	E	-	-	-	-		EQSLRDKGIYHNTAPV	TOPO_DOM /note="Extracellular" TOPO_DOM /note="Extracellular"
42	P	-	-	-	-		PKVRSLINDAEQYGT	TOPO_DOM /note="Extracellular" TOPO_DOM /note="Extracellular"
43	A	-	-	-	-		ASTLQVKPCEYGHR	TOPO_DOM /note="Extracellular" TOPO_DOM /note="Extracellular"
44	F	-	-	-	-		LYFVNEPQSWAIKRTG	TOPO_DOM /note="Extracellular" TOPO_DOM /note="Extracellular"
45	T	-	-	-	-		SVTLNQCFPAKRHIEG	TOPO_DOM /note="Extracellular" TOPO_DOM /note="Extracellular"
46	P	-	-	-	-		PLASVKNQERCDHITFG	TOPO_DOM /note="Extracellular" TOPO_DOM /note="Extracellular"
47	G	-	-	-	-		GSKTERNADILMQFPVY	TOPO_DOM /note="Extracellular" TOPO_DOM /note="Extracellular"
48	P	-	-	-	-		PKELTDNRASHMQFGIV	TOPO_DOM /note="Extracellular" TOPO_DOM /note="Extracellular"
49	N	-	-	-	-		NTESVKLACRIQYGHDFP	TOPO_DOM /note="Extracellular" TOPO_DOM /note="Extracellular"
50	I	-	-	-	-		LTVIPEMARCGKSYDFHNQ	TOPO_DOM /note="Extracellular" TOPO_DOM /note="Extracellular"
51	E	-	-	-	-		EDQKRSLTNFVPAGCIY	TOPO_DOM /note="Extracellular" TOPO_DOM /note="Extracellular"
52	L	-	-	-	-		LIKTVGSAFPREMNDHQY	TOPO_DOM /note="Extracellular" TOPO_DOM /note="Extracellular"
53	Q	-	-	-	-		QTSKLNERDHPAFGIMWVY	TOPO_DOM /note="Extracellular" TOPO_DOM /note="Extracellular"
54	K	-	-	-	-		KSGTNRDEQAILVFPY	TOPO_DOM /note="Extracellular" TOPO_DOM /note="Extracellular"
55	D	-	-	-	-		DEGSRNATVIQLFHKP	TOPO_DOM /note="Extracellular" TOPO_DOM /note="Extracellular"
56	S	-	-	-	-		SAHGITQRKNPELVCDF	TOPO_DOM /note="Extracellular" TOPO_DOM /note="Extracellular"
57	D		e	96.3	3cdg_G		DKETHLAYNSGFPRQVI	TOPO_DOM /note="Extracellular" TOPO_DOM /note="Extracellular"
58	C		e	37.3	3cdg_G	hetero NKG2A_HUMAN	CITVSAYLPGHKRDEQW	DISULFID ECO:0000269|PubMed:18332182" TOPO_DOM /note="Extracellular" DISULFID ECO:0000269|PubMed:18332182" TOPO_DOM /note="Extracellular"
59	C		e	80.0	3cdg_G	hetero NKG2A_HUMAN	SLCAGNREDKPQHTIVY	DISULFID /note="Interchain (with C-116 in KLRC1/NGK2A)" ECO:0000269|PubMed:18332182" DISULFID /note="Interchain (with C-116 in KLRC1/NGK2A)" ECO:0000269|PubMed:18332182" TOPO_DOM /note="Extracellular" DISULFID /note="Interchain (with C-116 in KLRC1/NGK2A)" ECO:0000269|PubMed:18332182" DISULFID /note="Interchain (with C-116 in KLRC1/NGK2A)" ECO:0000269|PubMed:18332182" TOPO_DOM /note="Extracellular"
60	S		e	59.4	3cdg_G		PASEGNTDLVCHQKYFIR	TOPO_DOM /note="Extracellular" TOPO_DOM /note="Extracellular"
61	C		b	11.3	3cdg_G		CGVSQT	DISULFID ECO:0000269|PubMed:18083576, ECO:0000269|PubMed:18332182, ECO:0000269|PubMed:18448674" TOPO_DOM /note="Extracellular" DISULFID ECO:0000269|PubMed:18083576, ECO:0000269|PubMed:18332182, ECO:0000269|PubMed:18448674" TOPO_DOM /note="Extracellular"
62	Q		e	47.4	3cdg_G		PSLDEKANQVHT	TOPO_DOM /note="Extracellular" TOPO_DOM /note="Extracellular"
63	E	S	e	71.4	3cdg_G	hetero NKG2A_HUMAN	EPKSQRLTVHNWDIYAFG	TOPO_DOM /note="Extracellular" TOPO_DOM /note="Extracellular"
64	K	S	e	77.4	3cdg_G	hetero NKG2A_HUMAN	GDNHEKSYRTLMPQ	TOPO_DOM /note="Extracellular" TOPO_DOM /note="Extracellular"
65	W		b	11.2	3cdg_G	hetero NKG2A_HUMAN	WST	TOPO_DOM /note="Extracellular" TOPO_DOM /note="Extracellular"
66	V	E	e	36.7	3cdg_G	hetero NKG2A_HUMAN	ILSKVTFEHNQDMRAY	TOPO_DOM /note="Extracellular" TOPO_DOM /note="Extracellular"
67	G	E	e	57.1	3cdg_G	hetero NKG2A_HUMAN	SWGPAFCKNELTYQHIMRV	TOPO_DOM /note="Extracellular" TOPO_DOM /note="Extracellular"
68	Y	E	e	24.3	3cdg_G	hetero NKG2A_HUMAN	YFHNVLSKQ	DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular"
69	R	T	e	54.9	3cdg_G	hetero NKG2A_HUMAN	GQERNKDSTWCHL	DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular"
70	C	T	e	31.3	3cdg_G	hetero NKG2A_HUMAN	GNDSEKRQCTVAILM	DISULFID ECO:0000269|PubMed:18332182" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DISULFID ECO:0000269|PubMed:18332182" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular"
71	N	E	b	11.5	3cdg_G		KNSHDYFQRTA	DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular"
72	C	E	b	0.0	3cdg_G		CF	DISULFID ECO:0000269|PubMed:18083576, ECO:0000269|PubMed:18332182, ECO:0000269|PubMed:18448674" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DISULFID ECO:0000269|PubMed:18083576, ECO:0000269|PubMed:18332182, ECO:0000269|PubMed:18448674" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular"
73	Y	E	b	0.9	3cdg_G		YFLI	DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular"
74	F	E	b	13.4	3cdg_G		YFKLHRWMQGSCI	DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular"
75	I	E	e	24.6	3cdg_G	hetero NKG2A_HUMAN	FVILAHYMPTQ	DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular"
76	S		b	2.3	3cdg_G		SFIGHLNAQTVYER	DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular"
77	S		e	61.7	3cdg_G	hetero NKG2A_HUMAN HLAE_HUMAN	ENKQTSRGMPADHILVFY	DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular"
78	E	S	e	57.3	3cdg_G		EDSTPQGIKNRVYHAFL	DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular"
79	Q		e	41.8	3cdg_G		KRSEAPQLNTGWYMVDFH	MUTAGEN /note="Q->A: Has no impact on the affinity for HLA-E." DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" MUTAGEN /note="Q->A: Has no impact on the affinity for HLA-E." DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular"
80	K	B	e	32.1	3cdg_G		KRNEDFMSQGLTIVA	DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular"
81	T		b	5.8	3cdg_G		TNSPIDAFMQRV	DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular"
82	W	H	b	8.4	3cdg_G		WFYK	DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular"
83	N	H	e	43.0	3cdg_G		EANSDTQHYKVILMPR	CARBOHYD /note="N-linked (GlcNAc...) asparagine" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" CARBOHYD /note="N-linked (GlcNAc...) asparagine" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular"
84	E	H	e	32.7	3cdg_G		EDGKAFLQNRSHIT	DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular"
85	S	H	b	0.0	3cdg_G		ASGCN	DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular"
86	R	H	e	36.0	3cdg_G		EQKRLVDHAIMTY	DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular"
87	H	H	e	61.8	3cdg_G		KRQALMTESDNVYFHI	DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular"
88	L	H	e	30.9	3cdg_G		FAYNDSKELQRTHI	DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular"
89	C	H	b	0.0	3cdg_G		C	DISULFID ECO:0000269|PubMed:18083576, ECO:0000269|PubMed:18332182, ECO:0000269|PubMed:18448674" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DISULFID ECO:0000269|PubMed:18083576, ECO:0000269|PubMed:18332182, ECO:0000269|PubMed:18448674" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular"
90	A	H	e	50.9	3cdg_G		QTSKLRAMEDIVGFHN	DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular"
91	S	H	e	64.1	3cdg_G		ESADQGKLHTRMNIV	DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular"
92	Q	T	e	42.3	3cdg_G		QKELMHYFRVDNSAGP	DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular"
93	K	T	e	75.5	3cdg_G		GNHQSDEKARTVY	DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular"
94	S		b	14.1	3cdg_G		ASGELNPVDKT	DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular"
95	S	E	e	49.2	3cdg_G		HTSQGNDEPVAIRY	DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular"
96	L	E	b	0.0	3cdg_G		LGIM	DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular"
97	L		b	0.0	3cdg_G		VLAITPQSFGM	DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular"
98	Q		b	14.8	3cdg_G		SKLQVIRTDFAN	DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular"
99	L		b	3.4	3cdg_G		IFVLAMEPT	DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular"
100	Q	S	e	56.1	3cdg_G		DHNQESKTALRGVIPY	DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular"
101	N	S	e	46.1	3cdg_G		SNTDGHIK	DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular"
102	T	T	e	35.1	3cdg_G		EQKSTRLPANIDGVFHMWY	DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular"
103	D	T	e	53.1	3cdg_G		EDANKQGLST	DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular"
104	E	T	b	3.0	3cdg_G		EDVKTAGIS	DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular"
105	L	T	b	0.0	3cdg_G		LQVAMFGHNIKPST	DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular"
106	D	G	e	42.6	3cdg_G	hetero NKG2A_HUMAN	DENKARSGQTILM	DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular"
107	F	G	e	38.3	3cdg_G	hetero NKG2A_HUMAN	FLVYDSWEGKMN	DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular"
108	M	G	b	10.1	3cdg_G	hetero NKG2A_HUMAN	LIVMFSAQR	DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular"
109	S	T	e	44.5	3cdg_G	hetero NKG2A_HUMAN	SKVQRTANLGYDIMEH	DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular"
110	S	T	e	89.8	3cdg_G	hetero NKG2A_HUMAN HLAG_HUMAN	KSRLFQTGADNEHYPVIM	DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular"
111	S		b	15.6	3cdg_G	hetero NKG2A_HUMAN HLAG_HUMAN	SGKNREITHVYADFQPLM	DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular"
112	Q		e	87.8	3cdg_G	hetero HLAE_HUMAN HLAG_HUMAN	KSTERADQGLNPVHIWMY	MUTAGEN /note="Q->A: Abolishes binding to HLA-E." DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" MUTAGEN /note="Q->A: Abolishes binding to HLA-E." DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular"
113	Q		e	35.7	3cdg_G	hetero HLAE_HUMAN	SDREGKQNFPTAHIYLMV	DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular"
114	F		e	30.1	3cdg_G	hetero HLAE_HUMAN HLAG_HUMAN	FSYNEGLDIPVAHMRKQ	MUTAGEN /note="F->A: Abolishes binding to HLA-E." DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" MUTAGEN /note="F->A: Abolishes binding to HLA-E." DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular"
115	Y	E	b	7.0	3cdg_G	hetero NKG2A_HUMAN	FYVHSTGILQACMPR	DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular"
116	W	E	b	0.0	3cdg_G		WFH	DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular"
117	I		b	0.0	3cdg_G		IMLVTF	DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular"
118	G	S	b	0.0	3cdg_G		GLADNW	DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular"
119	L	E	b	0.0	3cdg_G		LVAIMEH	DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular"
120	S	E	e	27.3	3cdg_G		SRNHTKFLQVWYAEGI	DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular"
121	Y	E	e	27.4	3cdg_G		DRYNLKQFHMPSAIVW	DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular"
122	S	E	b	8.6	3cdg_G		DVSTEILNPRKQGFAHMY	DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular"
123	E	T	e	79.9	3cdg_G		KNWESDGPQLTRAFHM	DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular"
124	E	T	e	71.9	3cdg_G		SKNQRTEAIPDFGLVHM	DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular"
125	H	T	e	63.9	3cdg_G		ENKDGQRHSIPAV	DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular"
126	T	T	e	66.9	3cdg_G		GKCHRSNDMQTVAEFPY	DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular"
127	A	E	e	29.5	3cdg_G		SPDTNEGAQRHILKMVFY	DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular"
128	W	E	b	7.2	3cdg_G		WFLSYKPRTV	DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular"
129	L	E	b	12.4	3cdg_G		KLQREVHAGFIMPSTY	DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular"
130	W	E	b	6.0	3cdg_G		WLTR	DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular"
131	E	T	e	40.7	3cdg_G		SEIVTLDMAFGHKNPQR	DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular"
132	N	T	e	59.4	3cdg_G		DNETAGS	CARBOHYD /note="N-linked (GlcNAc...) asparagine" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" CARBOHYD /note="N-linked (GlcNAc...) asparagine" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular"
133	G	S	e	60.7	3cdg_G		GDNKESYAHQR	DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular"
134	S		e	42.2	3cdg_G		STAIEHLPVMQDKR	DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular"
135	A	B	e	63.4	3cdg_G		PSAKTNVEFIDGLQHMR	DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular"
136	L		b	6.7	3cdg_G		LFVYIPTAKNMRW	DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular"
137	S		e	39.1	3cdg_G		SNTDKLPEHQGRVAIM	DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular"
138	Q	T	e	64.3	3cdg_G		SYPQKFLNHEGTDRAIV	DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular"
139	Y	T	e	80.9	3cdg_G		TENKYDSFGQHLRWIMVAP	DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular"
140	L	T	b	12.9	3cdg_G		LANIVFKSGRYWDEHMPQT	DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular"
141	F	S	b	1.0	3cdg_G		WFLAEIYKRTMNSDGHPQV	DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular"
142	P	T	e	81.4	3cdg_G		PSKNEDGTWALRVFHQIY	DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular"
143	S	T	e	41.4	3cdg_G	hetero HLAE_HUMAN	SADQENGIRKPTFHLVMY	DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular"
144	F	G	b	19.1	3cdg_G		FGSIYELDHTVMNPRWKA	DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular"
145	E	G	e	71.9	3cdg_G		ETGKQDNPSRFAHLIVWY	DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular"
146	T	G	e	72.7	3cdg_G	hetero HLAE_HUMAN	PSANDGTILQEFKVHMRYC	MUTAGEN /note="T->A: Has no impact on the affinity for HLA-E." DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" MUTAGEN /note="T->A: Has no impact on the affinity for HLA-E." DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular"
147	F	S	b	5.7	3cdg_G		NYFGLWDAISTKEQVHPRM	DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular"
148	N		e	43.6	3cdg_G		NGDEKPRSATQVYFHILW	MUTAGEN /note="N->A: Has no impact on the affinity for HLA-E." DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" MUTAGEN /note="N->A: Has no impact on the affinity for HLA-E." DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular"
149	T	T	e	36.4	3cdg_G		ESGKNTPADIFLCMRVQW	DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular"
150	K	T	e	77.4	3cdg_G		EGKRPSDNQAHCFILMTV	DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular"
151	N	E	b	20.0	3cdg_G		NDSEFKGHQRTYILVCMP	DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular"
152	C	E	b	1.3	3cdg_G		CHSVGINDPRT	DISULFID ECO:0000269|PubMed:18083576, ECO:0000269|PubMed:18332182, ECO:0000269|PubMed:18448674" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DISULFID ECO:0000269|PubMed:18083576, ECO:0000269|PubMed:18332182, ECO:0000269|PubMed:18448674" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular"
153	I	E	b	0.0	3cdg_G		VAICGFSLDEMQT	DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular"
154	A	E	b	0.0	3cdg_G		AVGESCTIMYHLFNW	DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular"
155	Y	E	b	0.4	3cdg_G		YLFIWMSHVAECGKN	DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular"
156	N	E	b	2.4	3cdg_G	hetero HLAG_HUMAN	NKILSTHEGQRFYDAVW	DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular"
157	P	T	b	1.6	3cdg_G		SPKLTEAGDHQVIYCFNR	DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular"
158	N	T	e	54.5	3cdg_G	hetero HLAG_HUMAN	SDTNREKAGHQLFVWY	MUTAGEN /note="N->A: Has no impact on the affinity for HLA-E." DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" MUTAGEN /note="N->A: Has no impact on the affinity for HLA-E." DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular"
159	G	T	e	26.2	3cdg_G		GDKTSANEFPRVCHMWY	DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular"
160	N	E	e	60.0	3cdg_G	hetero HLAE_HUMAN HLAG_HUMAN	NKQRTELHAGSWDIVCMP	MUTAGEN /note="N->A: Abolishes binding to HLA-E." DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" MUTAGEN /note="N->A: Abolishes binding to HLA-E." DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular"
161	A	E	b	14.3	3cdg_G	hetero HLAE_HUMAN	WVILQFYAGKNHCMPRST	DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular"
162	L	E	e	41.6	3cdg_G	hetero HLAE_HUMAN	LNFYKWVMHSDIEAGPQT	MUTAGEN /note="L->A: Abolishes binding to HLA-E." DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" MUTAGEN /note="L->A: Abolishes binding to HLA-E." DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular"
163	D	E	e	29.6	3cdg_G	hetero HLAE_HUMAN	DSAPVERIKNTYFGH	MUTAGEN /note="D->A: Impairs binding to HLA-E." DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" MUTAGEN /note="D->A: Impairs binding to HLA-E." DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular"
164	E	E	e	33.2	3cdg_G	hetero HLAE_HUMAN	EDARKTQVSNMFLHIWY	MUTAGEN /note="E->A: Impairs binding to HLA-E." DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" MUTAGEN /note="E->A: Impairs binding to HLA-E." DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular"
165	S	E	e	33.6	3cdg_G		SDNPFKRYAEGQTIVHL	DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular"
166	C	T	e	24.7	3cdg_G		CDY	DISULFID ECO:0000269|PubMed:18083576, ECO:0000269|PubMed:18332182, ECO:0000269|PubMed:18448674" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DISULFID ECO:0000269|PubMed:18083576, ECO:0000269|PubMed:18332182, ECO:0000269|PubMed:18448674" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular"
167	E	T	e	64.3	3cdg_G		SENDRTKAGILQCFY	DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular"
168	D	S	e	45.1	3cdg_G		SDETKRLANVYQGMFI	MUTAGEN /note="D->A: Reduces binding to HLA-E." DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" MUTAGEN /note="D->A: Reduces binding to HLA-E." DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular"
169	K		e	52.8	3cdg_G		KTPRDLEHVSANMIWY	DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular"
170	N	B	b	12.1	3cdg_G	hetero HLAE_HUMAN	NKHLRYFAQSIDECGT	DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular"
171	R	E	b	19.0	3cdg_G	hetero HLAE_HUMAN NKG2A_HUMAN	RYNPHKFSTGAILQM	DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular"
172	Y	E	b	6.5	3cdg_G		WFYSCVILTGR	DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular"
173	I	E	b	0.0	3cdg_G		IVLTAHMY	DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular"
174	C	E	b	0.0	3cdg_G		CL	DISULFID ECO:0000269|PubMed:18083576, ECO:0000269|PubMed:18332182, ECO:0000269|PubMed:18448674" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DISULFID ECO:0000269|PubMed:18083576, ECO:0000269|PubMed:18332182, ECO:0000269|PubMed:18448674" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular"
175	K	E	b	5.7	3cdg_G		KEQSAMRVGN	DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular"
176	Q	E	b	15.3	3cdg_G		KRFMQTHAESILY	TOPO_DOM /note="Extracellular" TOPO_DOM /note="Extracellular"
177	Q		e	50.0	3cdg_G		KERQPTDGSIVYMN	TOPO_DOM /note="Extracellular" TOPO_DOM /note="Extracellular"
178	L		e	30.9	3cdg_G		LVKAIMTYDF	TOPO_DOM /note="Extracellular" TOPO_DOM /note="Extracellular"
179	I		e	102.9	3cdg_G		IVML	TOPO_DOM /note="Extracellular" TOPO_DOM /note="Extracellular"