Contact Molecules for Homologous Proteins | ||||
[Summary Bars] |
[Full Bars] |
|
[Back to Search Page] |
[Back to HOMCOS] |
[Sites by Variants] |
[SupCon3D] |
[help] |
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100] | [show] [download] [help] |
PID | QueryLength | Homolgous Sequence in PDB | UniProt Query | TITLE |
2727836 | 179 | 7 | Q13241(KLRD1_HUMAN) | RecName: Full=Natural killer cells antigen CD94;AltName: Full=KP43;AltName: Full=Killer cell lectin-like receptor subfamily D member 1;AltName: Full=NK cell receptor;AltName: CD_antigen=CD94 ; |
QUERYSEQ |
MAVFKTTLWRLISGTLGIICLSLMSTLGILLKNSFTKLSIEPAFTPGPNIELQKDSDCCSCQEKWVGYRCNCYFISSEQKTWNESRHLCASQKSSLLQLQNTDELDFMSSSQQFYWIGLSYSEEHTAWLWENGSALSQYLFPSFETFNTK NCIAYNPNGNALDESCEDKNRYICKQQLI |
[n]:site number of query sequence. [a]:amino acid of query sequence. [s]:predicted secondary structure. [e]:predicted exposed/buried. [acc]:predicted relative accesssibility(%). [pdb]:PDB code of homologous structure. [contact_mols]:predicted binding molecules [observed aa]:Observed amino acids among homologous sequences. [feature table]:UniProt Feature Table [variant]:UniProt Human Variant.
n | a | s | e | acc | pdb | contact_mols | observed aa | feature table | variant |
1 | M | - | - | - | - | M |
TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
2 | A | - | - | - | - | AS |
TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
3 | V | - | - | - | - | VAI |
TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED TOPO_DOM /note="Cytoplasmic" | ||
4 | F | - | - | - | - | FSLK |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
5 | K | - | - | - | - | KQREA |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
6 | T | - | - | - | - | TSDALI |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
7 | T | - | - | - | - | TVKLA |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" | ||
8 | L | - | - | - | - | LTVIRA |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED | ||
9 | W | - | - | - | - | WTA |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED | ||
10 | R | - | - | - | - | RHKQMSN |
TOPO_DOM /note="Cytoplasmic" TOPO_DOM /note="Cytoplasmic" DISORDER predicted by DISOPRED | ||
11 | L | - | - | - | - | LMRVFIS |
TRANSMEM /note="Helical; Signal-anchor for type II membrane protein" TRANSMEM /note="Helical; Signal-anchor for type II membrane protein" DISORDER predicted by DISOPRED | ||
12 | I | - | - | - | - | ILVTMQ |
TRANSMEM /note="Helical; Signal-anchor for type II membrane protein" TRANSMEM /note="Helical; Signal-anchor for type II membrane protein" DISORDER predicted by DISOPRED | ||
13 | S | - | - | - | - | ASTIVLP |
TRANSMEM /note="Helical; Signal-anchor for type II membrane protein" TRANSMEM /note="Helical; Signal-anchor for type II membrane protein" DISORDER predicted by DISOPRED | ||
14 | G | - | - | - | - | GVSKLECIMA |
TRANSMEM /note="Helical; Signal-anchor for type II membrane protein" TRANSMEM /note="Helical; Signal-anchor for type II membrane protein" DISORDER predicted by DISOPRED | ||
15 | T | - | - | - | - | VIAKTGFCMP |
TRANSMEM /note="Helical; Signal-anchor for type II membrane protein" TRANSMEM /note="Helical; Signal-anchor for type II membrane protein" DISORDER predicted by DISOPRED | ||
16 | L | - | - | - | - | LIMFGSVW |
TRANSMEM /note="Helical; Signal-anchor for type II membrane protein" TRANSMEM /note="Helical; Signal-anchor for type II membrane protein" DISORDER predicted by DISOPRED | ||
17 | G | - | - | - | - | GAISFT |
TRANSMEM /note="Helical; Signal-anchor for type II membrane protein" TRANSMEM /note="Helical; Signal-anchor for type II membrane protein" DISORDER predicted by DISOPRED | ||
18 | I | - | - | - | - | IVCATKL |
TRANSMEM /note="Helical; Signal-anchor for type II membrane protein" TRANSMEM /note="Helical; Signal-anchor for type II membrane protein" DISORDER predicted by DISOPRED | ||
19 | I | - | - | - | - | ILVAKMFRS |
TRANSMEM /note="Helical; Signal-anchor for type II membrane protein" TRANSMEM /note="Helical; Signal-anchor for type II membrane protein" DISORDER predicted by DISOPRED | ||
20 | C | - | - | - | - | CLVIAGSF |
TRANSMEM /note="Helical; Signal-anchor for type II membrane protein" TRANSMEM /note="Helical; Signal-anchor for type II membrane protein" DISORDER predicted by DISOPRED | ||
21 | L | - | - | - | - | LVIFACT |
TRANSMEM /note="Helical; Signal-anchor for type II membrane protein" TRANSMEM /note="Helical; Signal-anchor for type II membrane protein" DISORDER predicted by DISOPRED | ||
22 | S | - | - | - | - | VILSKARFGQM |
TRANSMEM /note="Helical; Signal-anchor for type II membrane protein" TRANSMEM /note="Helical; Signal-anchor for type II membrane protein" DISORDER predicted by DISOPRED | ||
23 | L | - | - | - | - | LIVMT |
TRANSMEM /note="Helical; Signal-anchor for type II membrane protein" TRANSMEM /note="Helical; Signal-anchor for type II membrane protein" DISORDER predicted by DISOPRED | ||
24 | M | - | - | - | - | MLVIFYCR |
TRANSMEM /note="Helical; Signal-anchor for type II membrane protein" TRANSMEM /note="Helical; Signal-anchor for type II membrane protein" DISORDER predicted by DISOPRED | ||
25 | S | - | - | - | - | VASTFGICKM |
TRANSMEM /note="Helical; Signal-anchor for type II membrane protein" TRANSMEM /note="Helical; Signal-anchor for type II membrane protein" DISORDER predicted by DISOPRED | S->A:(20.0 %):LB/B - dbSNP:rs1077225 | |
26 | T | - | - | - | - | TVIGNSAKLMYC |
TRANSMEM /note="Helical; Signal-anchor for type II membrane protein" TRANSMEM /note="Helical; Signal-anchor for type II membrane protein" DISORDER predicted by DISOPRED | ||
27 | L | - | - | - | - | VLMTSIAYW |
TRANSMEM /note="Helical; Signal-anchor for type II membrane protein" TRANSMEM /note="Helical; Signal-anchor for type II membrane protein" DISORDER predicted by DISOPRED | ||
28 | G | - | - | - | - | GSVANFIMKLP |
TRANSMEM /note="Helical; Signal-anchor for type II membrane protein" TRANSMEM /note="Helical; Signal-anchor for type II membrane protein" DISORDER predicted by DISOPRED | ||
29 | I | - | - | - | - | VIFATLMS |
TRANSMEM /note="Helical; Signal-anchor for type II membrane protein" TRANSMEM /note="Helical; Signal-anchor for type II membrane protein" | ||
30 | L | - | - | - | - | LIVMGAKW |
TRANSMEM /note="Helical; Signal-anchor for type II membrane protein" TRANSMEM /note="Helical; Signal-anchor for type II membrane protein" | ||
31 | L | - | - | - | - | LVMIAFQRCTE |
TRANSMEM /note="Helical; Signal-anchor for type II membrane protein" TRANSMEM /note="Helical; Signal-anchor for type II membrane protein" | ||
32 | K | - | - | - | - | KPVQRGNSTLACEIW |
TOPO_DOM /note="Extracellular" TOPO_DOM /note="Extracellular" | ||
33 | N | - | - | - | - | NLSKVHADEFIQRTG |
TOPO_DOM /note="Extracellular" TOPO_DOM /note="Extracellular" | ||
34 | S | - | - | - | - | SLTAEGHNICFVWP |
TOPO_DOM /note="Extracellular" DISORDER predicted by DISOPRED TOPO_DOM /note="Extracellular" | ||
35 | F | - | - | - | - | FVILHAYCRSDT |
TOPO_DOM /note="Extracellular" TOPO_DOM /note="Extracellular" | ||
36 | T | - | - | - | - | TSAVQELGNIFDPY |
TOPO_DOM /note="Extracellular" TOPO_DOM /note="Extracellular" | ||
37 | K | - | - | - | - | KVQRTACIELGPSN |
TOPO_DOM /note="Extracellular" TOPO_DOM /note="Extracellular" | ||
38 | L | - | - | - | - | LVPISEQCGRTFNK |
TOPO_DOM /note="Extracellular" TOPO_DOM /note="Extracellular" | ||
39 | S | - | - | - | - | SANELCPQRKTWGHV |
TOPO_DOM /note="Extracellular" TOPO_DOM /note="Extracellular" | ||
40 | I | - | - | - | - | LIVTFMERQSKAGNP |
TOPO_DOM /note="Extracellular" TOPO_DOM /note="Extracellular" | ||
41 | E | - | - | - | - | EQSLRDKGIYHNTAPV |
TOPO_DOM /note="Extracellular" TOPO_DOM /note="Extracellular" | ||
42 | P | - | - | - | - | PKVRSLINDAEQYGT |
TOPO_DOM /note="Extracellular" TOPO_DOM /note="Extracellular" | ||
43 | A | - | - | - | - | ASTLQVKPCEYGHR |
TOPO_DOM /note="Extracellular" TOPO_DOM /note="Extracellular" | ||
44 | F | - | - | - | - | LYFVNEPQSWAIKRTG |
TOPO_DOM /note="Extracellular" TOPO_DOM /note="Extracellular" | ||
45 | T | - | - | - | - | SVTLNQCFPAKRHIEG |
TOPO_DOM /note="Extracellular" TOPO_DOM /note="Extracellular" | ||
46 | P | - | - | - | - | PLASVKNQERCDHITFG |
TOPO_DOM /note="Extracellular" TOPO_DOM /note="Extracellular" | ||
47 | G | - | - | - | - | GSKTERNADILMQFPVY |
TOPO_DOM /note="Extracellular" TOPO_DOM /note="Extracellular" | ||
48 | P | - | - | - | - | PKELTDNRASHMQFGIV |
TOPO_DOM /note="Extracellular" TOPO_DOM /note="Extracellular" | ||
49 | N | - | - | - | - | NTESVKLACRIQYGHDFP |
TOPO_DOM /note="Extracellular" TOPO_DOM /note="Extracellular" | ||
50 | I | - | - | - | - | LTVIPEMARCGKSYDFHNQ |
TOPO_DOM /note="Extracellular" TOPO_DOM /note="Extracellular" | ||
51 | E | - | - | - | - | EDQKRSLTNFVPAGCIY |
TOPO_DOM /note="Extracellular" TOPO_DOM /note="Extracellular" | ||
52 | L | - | - | - | - | LIKTVGSAFPREMNDHQY |
TOPO_DOM /note="Extracellular" TOPO_DOM /note="Extracellular" | ||
53 | Q | - | - | - | - | QTSKLNERDHPAFGIMWVY |
TOPO_DOM /note="Extracellular" TOPO_DOM /note="Extracellular" | ||
54 | K | - | - | - | - | KSGTNRDEQAILVFPY |
TOPO_DOM /note="Extracellular" TOPO_DOM /note="Extracellular" | ||
55 | D | - | - | - | - | DEGSRNATVIQLFHKP |
TOPO_DOM /note="Extracellular" TOPO_DOM /note="Extracellular" | ||
56 | S | - | - | - | - | SAHGITQRKNPELVCDF |
TOPO_DOM /note="Extracellular" TOPO_DOM /note="Extracellular" | ||
57 | D | e | 96.3 | 3cdg_G | DKETHLAYNSGFPRQVI |
TOPO_DOM /note="Extracellular" TOPO_DOM /note="Extracellular" | |||
58 | C | e | 37.3 | 3cdg_G | hetero NKG2A_HUMAN | CITVSAYLPGHKRDEQW |
DISULFID ECO:0000269|PubMed:18332182" TOPO_DOM /note="Extracellular" DISULFID ECO:0000269|PubMed:18332182" TOPO_DOM /note="Extracellular" | ||
59 | C | e | 80.0 | 3cdg_G | hetero NKG2A_HUMAN | SLCAGNREDKPQHTIVY |
DISULFID /note="Interchain (with C-116 in KLRC1/NGK2A)" ECO:0000269|PubMed:18332182" DISULFID /note="Interchain (with C-116 in KLRC1/NGK2A)" ECO:0000269|PubMed:18332182" TOPO_DOM /note="Extracellular" DISULFID /note="Interchain (with C-116 in KLRC1/NGK2A)" ECO:0000269|PubMed:18332182" DISULFID /note="Interchain (with C-116 in KLRC1/NGK2A)" ECO:0000269|PubMed:18332182" TOPO_DOM /note="Extracellular" | ||
60 | S | e | 59.4 | 3cdg_G | PASEGNTDLVCHQKYFIR |
TOPO_DOM /note="Extracellular" TOPO_DOM /note="Extracellular" | |||
61 | C | b | 11.3 | 3cdg_G | CGVSQT |
DISULFID ECO:0000269|PubMed:18083576, ECO:0000269|PubMed:18332182, ECO:0000269|PubMed:18448674" TOPO_DOM /note="Extracellular" DISULFID ECO:0000269|PubMed:18083576, ECO:0000269|PubMed:18332182, ECO:0000269|PubMed:18448674" TOPO_DOM /note="Extracellular" | |||
62 | Q | e | 47.4 | 3cdg_G | PSLDEKANQVHT |
TOPO_DOM /note="Extracellular" TOPO_DOM /note="Extracellular" | |||
63 | E | S | e | 71.4 | 3cdg_G | hetero NKG2A_HUMAN | EPKSQRLTVHNWDIYAFG |
TOPO_DOM /note="Extracellular" TOPO_DOM /note="Extracellular" | |
64 | K | S | e | 77.4 | 3cdg_G | hetero NKG2A_HUMAN | GDNHEKSYRTLMPQ |
TOPO_DOM /note="Extracellular" TOPO_DOM /note="Extracellular" | |
65 | W | b | 11.2 | 3cdg_G | hetero NKG2A_HUMAN | WST |
TOPO_DOM /note="Extracellular" TOPO_DOM /note="Extracellular" | ||
66 | V | E | e | 36.7 | 3cdg_G | hetero NKG2A_HUMAN | ILSKVTFEHNQDMRAY |
TOPO_DOM /note="Extracellular" TOPO_DOM /note="Extracellular" | |
67 | G | E | e | 57.1 | 3cdg_G | hetero NKG2A_HUMAN | SWGPAFCKNELTYQHIMRV |
TOPO_DOM /note="Extracellular" TOPO_DOM /note="Extracellular" | |
68 | Y | E | e | 24.3 | 3cdg_G | hetero NKG2A_HUMAN | YFHNVLSKQ |
DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" | |
69 | R | T | e | 54.9 | 3cdg_G | hetero NKG2A_HUMAN | GQERNKDSTWCHL |
DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" | |
70 | C | T | e | 31.3 | 3cdg_G | hetero NKG2A_HUMAN | GNDSEKRQCTVAILM |
DISULFID ECO:0000269|PubMed:18332182" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DISULFID ECO:0000269|PubMed:18332182" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" | |
71 | N | E | b | 11.5 | 3cdg_G | KNSHDYFQRTA |
DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" | ||
72 | C | E | b | 0.0 | 3cdg_G | CF |
DISULFID ECO:0000269|PubMed:18083576, ECO:0000269|PubMed:18332182, ECO:0000269|PubMed:18448674" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DISULFID ECO:0000269|PubMed:18083576, ECO:0000269|PubMed:18332182, ECO:0000269|PubMed:18448674" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" | ||
73 | Y | E | b | 0.9 | 3cdg_G | YFLI |
DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" | ||
74 | F | E | b | 13.4 | 3cdg_G | YFKLHRWMQGSCI |
DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" | ||
75 | I | E | e | 24.6 | 3cdg_G | hetero NKG2A_HUMAN | FVILAHYMPTQ |
DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" | |
76 | S | b | 2.3 | 3cdg_G | SFIGHLNAQTVYER |
DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" | |||
77 | S | e | 61.7 | 3cdg_G | hetero NKG2A_HUMAN HLAE_HUMAN | ENKQTSRGMPADHILVFY |
DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" | ||
78 | E | S | e | 57.3 | 3cdg_G | EDSTPQGIKNRVYHAFL |
DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" | ||
79 | Q | e | 41.8 | 3cdg_G | KRSEAPQLNTGWYMVDFH |
MUTAGEN /note="Q->A: Has no impact on the affinity for HLA-E." DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" MUTAGEN /note="Q->A: Has no impact on the affinity for HLA-E." DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" | |||
80 | K | B | e | 32.1 | 3cdg_G | KRNEDFMSQGLTIVA |
DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" | ||
81 | T | b | 5.8 | 3cdg_G | TNSPIDAFMQRV |
DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" | |||
82 | W | H | b | 8.4 | 3cdg_G | WFYK |
DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" | ||
83 | N | H | e | 43.0 | 3cdg_G | EANSDTQHYKVILMPR |
CARBOHYD /note="N-linked (GlcNAc...) asparagine" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" CARBOHYD /note="N-linked (GlcNAc...) asparagine" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" | ||
84 | E | H | e | 32.7 | 3cdg_G | EDGKAFLQNRSHIT |
DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" | ||
85 | S | H | b | 0.0 | 3cdg_G | ASGCN |
DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" | ||
86 | R | H | e | 36.0 | 3cdg_G | EQKRLVDHAIMTY |
DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" | ||
87 | H | H | e | 61.8 | 3cdg_G | KRQALMTESDNVYFHI |
DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" | ||
88 | L | H | e | 30.9 | 3cdg_G | FAYNDSKELQRTHI |
DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" | ||
89 | C | H | b | 0.0 | 3cdg_G | C |
DISULFID ECO:0000269|PubMed:18083576, ECO:0000269|PubMed:18332182, ECO:0000269|PubMed:18448674" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DISULFID ECO:0000269|PubMed:18083576, ECO:0000269|PubMed:18332182, ECO:0000269|PubMed:18448674" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" | ||
90 | A | H | e | 50.9 | 3cdg_G | QTSKLRAMEDIVGFHN |
DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" | ||
91 | S | H | e | 64.1 | 3cdg_G | ESADQGKLHTRMNIV |
DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" | ||
92 | Q | T | e | 42.3 | 3cdg_G | QKELMHYFRVDNSAGP |
DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" | ||
93 | K | T | e | 75.5 | 3cdg_G | GNHQSDEKARTVY |
DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" | ||
94 | S | b | 14.1 | 3cdg_G | ASGELNPVDKT |
DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" | |||
95 | S | E | e | 49.2 | 3cdg_G | HTSQGNDEPVAIRY |
DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" | ||
96 | L | E | b | 0.0 | 3cdg_G | LGIM |
DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" | ||
97 | L | b | 0.0 | 3cdg_G | VLAITPQSFGM |
DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" | |||
98 | Q | b | 14.8 | 3cdg_G | SKLQVIRTDFAN |
DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" | |||
99 | L | b | 3.4 | 3cdg_G | IFVLAMEPT |
DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" | |||
100 | Q | S | e | 56.1 | 3cdg_G | DHNQESKTALRGVIPY |
DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" | ||
101 | N | S | e | 46.1 | 3cdg_G | SNTDGHIK |
DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" | ||
102 | T | T | e | 35.1 | 3cdg_G | EQKSTRLPANIDGVFHMWY |
DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" | ||
103 | D | T | e | 53.1 | 3cdg_G | EDANKQGLST |
DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" | ||
104 | E | T | b | 3.0 | 3cdg_G | EDVKTAGIS |
DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" | ||
105 | L | T | b | 0.0 | 3cdg_G | LQVAMFGHNIKPST |
DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" | ||
106 | D | G | e | 42.6 | 3cdg_G | hetero NKG2A_HUMAN | DENKARSGQTILM |
DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" | |
107 | F | G | e | 38.3 | 3cdg_G | hetero NKG2A_HUMAN | FLVYDSWEGKMN |
DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" | |
108 | M | G | b | 10.1 | 3cdg_G | hetero NKG2A_HUMAN | LIVMFSAQR |
DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" | |
109 | S | T | e | 44.5 | 3cdg_G | hetero NKG2A_HUMAN | SKVQRTANLGYDIMEH |
DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" | |
110 | S | T | e | 89.8 | 3cdg_G | hetero NKG2A_HUMAN HLAG_HUMAN | KSRLFQTGADNEHYPVIM |
DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" | |
111 | S | b | 15.6 | 3cdg_G | hetero NKG2A_HUMAN HLAG_HUMAN | SGKNREITHVYADFQPLM |
DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" | ||
112 | Q | e | 87.8 | 3cdg_G | hetero HLAE_HUMAN HLAG_HUMAN | KSTERADQGLNPVHIWMY |
MUTAGEN /note="Q->A: Abolishes binding to HLA-E." DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" MUTAGEN /note="Q->A: Abolishes binding to HLA-E." DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" | ||
113 | Q | e | 35.7 | 3cdg_G | hetero HLAE_HUMAN | SDREGKQNFPTAHIYLMV |
DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" | ||
114 | F | e | 30.1 | 3cdg_G | hetero HLAE_HUMAN HLAG_HUMAN | FSYNEGLDIPVAHMRKQ |
MUTAGEN /note="F->A: Abolishes binding to HLA-E." DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" MUTAGEN /note="F->A: Abolishes binding to HLA-E." DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" | ||
115 | Y | E | b | 7.0 | 3cdg_G | hetero NKG2A_HUMAN | FYVHSTGILQACMPR |
DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" | |
116 | W | E | b | 0.0 | 3cdg_G | WFH |
DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" | ||
117 | I | b | 0.0 | 3cdg_G | IMLVTF |
DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" | |||
118 | G | S | b | 0.0 | 3cdg_G | GLADNW |
DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" | ||
119 | L | E | b | 0.0 | 3cdg_G | LVAIMEH |
DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" | ||
120 | S | E | e | 27.3 | 3cdg_G | SRNHTKFLQVWYAEGI |
DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" | ||
121 | Y | E | e | 27.4 | 3cdg_G | DRYNLKQFHMPSAIVW |
DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" | ||
122 | S | E | b | 8.6 | 3cdg_G | DVSTEILNPRKQGFAHMY |
DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" | ||
123 | E | T | e | 79.9 | 3cdg_G | KNWESDGPQLTRAFHM |
DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" | ||
124 | E | T | e | 71.9 | 3cdg_G | SKNQRTEAIPDFGLVHM |
DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" | ||
125 | H | T | e | 63.9 | 3cdg_G | ENKDGQRHSIPAV |
DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" | ||
126 | T | T | e | 66.9 | 3cdg_G | GKCHRSNDMQTVAEFPY |
DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" | ||
127 | A | E | e | 29.5 | 3cdg_G | SPDTNEGAQRHILKMVFY |
DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" | ||
128 | W | E | b | 7.2 | 3cdg_G | WFLSYKPRTV |
DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" | ||
129 | L | E | b | 12.4 | 3cdg_G | KLQREVHAGFIMPSTY |
DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" | ||
130 | W | E | b | 6.0 | 3cdg_G | WLTR |
DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" | ||
131 | E | T | e | 40.7 | 3cdg_G | SEIVTLDMAFGHKNPQR |
DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" | ||
132 | N | T | e | 59.4 | 3cdg_G | DNETAGS |
CARBOHYD /note="N-linked (GlcNAc...) asparagine" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" CARBOHYD /note="N-linked (GlcNAc...) asparagine" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" | ||
133 | G | S | e | 60.7 | 3cdg_G | GDNKESYAHQR |
DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" | ||
134 | S | e | 42.2 | 3cdg_G | STAIEHLPVMQDKR |
DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" | |||
135 | A | B | e | 63.4 | 3cdg_G | PSAKTNVEFIDGLQHMR |
DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" | ||
136 | L | b | 6.7 | 3cdg_G | LFVYIPTAKNMRW |
DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" | |||
137 | S | e | 39.1 | 3cdg_G | SNTDKLPEHQGRVAIM |
DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" | |||
138 | Q | T | e | 64.3 | 3cdg_G | SYPQKFLNHEGTDRAIV |
DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" | ||
139 | Y | T | e | 80.9 | 3cdg_G | TENKYDSFGQHLRWIMVAP |
DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" | ||
140 | L | T | b | 12.9 | 3cdg_G | LANIVFKSGRYWDEHMPQT |
DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" | ||
141 | F | S | b | 1.0 | 3cdg_G | WFLAEIYKRTMNSDGHPQV |
DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" | ||
142 | P | T | e | 81.4 | 3cdg_G | PSKNEDGTWALRVFHQIY |
DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" | ||
143 | S | T | e | 41.4 | 3cdg_G | hetero HLAE_HUMAN | SADQENGIRKPTFHLVMY |
DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" | |
144 | F | G | b | 19.1 | 3cdg_G | FGSIYELDHTVMNPRWKA |
DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" | ||
145 | E | G | e | 71.9 | 3cdg_G | ETGKQDNPSRFAHLIVWY |
DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" | ||
146 | T | G | e | 72.7 | 3cdg_G | hetero HLAE_HUMAN | PSANDGTILQEFKVHMRYC |
MUTAGEN /note="T->A: Has no impact on the affinity for HLA-E." DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" MUTAGEN /note="T->A: Has no impact on the affinity for HLA-E." DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" | |
147 | F | S | b | 5.7 | 3cdg_G | NYFGLWDAISTKEQVHPRM |
DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" | ||
148 | N | e | 43.6 | 3cdg_G | NGDEKPRSATQVYFHILW |
MUTAGEN /note="N->A: Has no impact on the affinity for HLA-E." DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" MUTAGEN /note="N->A: Has no impact on the affinity for HLA-E." DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" | |||
149 | T | T | e | 36.4 | 3cdg_G | ESGKNTPADIFLCMRVQW |
DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" | ||
150 | K | T | e | 77.4 | 3cdg_G | EGKRPSDNQAHCFILMTV |
DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" | ||
151 | N | E | b | 20.0 | 3cdg_G | NDSEFKGHQRTYILVCMP |
DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" | ||
152 | C | E | b | 1.3 | 3cdg_G | CHSVGINDPRT |
DISULFID ECO:0000269|PubMed:18083576, ECO:0000269|PubMed:18332182, ECO:0000269|PubMed:18448674" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DISULFID ECO:0000269|PubMed:18083576, ECO:0000269|PubMed:18332182, ECO:0000269|PubMed:18448674" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" | ||
153 | I | E | b | 0.0 | 3cdg_G | VAICGFSLDEMQT |
DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" | ||
154 | A | E | b | 0.0 | 3cdg_G | AVGESCTIMYHLFNW |
DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" | ||
155 | Y | E | b | 0.4 | 3cdg_G | YLFIWMSHVAECGKN |
DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" | ||
156 | N | E | b | 2.4 | 3cdg_G | hetero HLAG_HUMAN | NKILSTHEGQRFYDAVW |
DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" | |
157 | P | T | b | 1.6 | 3cdg_G | SPKLTEAGDHQVIYCFNR |
DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" | ||
158 | N | T | e | 54.5 | 3cdg_G | hetero HLAG_HUMAN | SDTNREKAGHQLFVWY |
MUTAGEN /note="N->A: Has no impact on the affinity for HLA-E." DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" MUTAGEN /note="N->A: Has no impact on the affinity for HLA-E." DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" | |
159 | G | T | e | 26.2 | 3cdg_G | GDKTSANEFPRVCHMWY |
DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" | ||
160 | N | E | e | 60.0 | 3cdg_G | hetero HLAE_HUMAN HLAG_HUMAN | NKQRTELHAGSWDIVCMP |
MUTAGEN /note="N->A: Abolishes binding to HLA-E." DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" MUTAGEN /note="N->A: Abolishes binding to HLA-E." DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" | |
161 | A | E | b | 14.3 | 3cdg_G | hetero HLAE_HUMAN | WVILQFYAGKNHCMPRST |
DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" | |
162 | L | E | e | 41.6 | 3cdg_G | hetero HLAE_HUMAN | LNFYKWVMHSDIEAGPQT |
MUTAGEN /note="L->A: Abolishes binding to HLA-E." DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" MUTAGEN /note="L->A: Abolishes binding to HLA-E." DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" | |
163 | D | E | e | 29.6 | 3cdg_G | hetero HLAE_HUMAN | DSAPVERIKNTYFGH |
MUTAGEN /note="D->A: Impairs binding to HLA-E." DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" MUTAGEN /note="D->A: Impairs binding to HLA-E." DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" | |
164 | E | E | e | 33.2 | 3cdg_G | hetero HLAE_HUMAN | EDARKTQVSNMFLHIWY |
MUTAGEN /note="E->A: Impairs binding to HLA-E." DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" MUTAGEN /note="E->A: Impairs binding to HLA-E." DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" | |
165 | S | E | e | 33.6 | 3cdg_G | SDNPFKRYAEGQTIVHL |
DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" | ||
166 | C | T | e | 24.7 | 3cdg_G | CDY |
DISULFID ECO:0000269|PubMed:18083576, ECO:0000269|PubMed:18332182, ECO:0000269|PubMed:18448674" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DISULFID ECO:0000269|PubMed:18083576, ECO:0000269|PubMed:18332182, ECO:0000269|PubMed:18448674" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" | ||
167 | E | T | e | 64.3 | 3cdg_G | SENDRTKAGILQCFY |
DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" | ||
168 | D | S | e | 45.1 | 3cdg_G | SDETKRLANVYQGMFI |
MUTAGEN /note="D->A: Reduces binding to HLA-E." DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" MUTAGEN /note="D->A: Reduces binding to HLA-E." DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" | ||
169 | K | e | 52.8 | 3cdg_G | KTPRDLEHVSANMIWY |
DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" | |||
170 | N | B | b | 12.1 | 3cdg_G | hetero HLAE_HUMAN | NKHLRYFAQSIDECGT |
DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" | |
171 | R | E | b | 19.0 | 3cdg_G | hetero HLAE_HUMAN NKG2A_HUMAN | RYNPHKFSTGAILQM |
DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" | |
172 | Y | E | b | 6.5 | 3cdg_G | WFYSCVILTGR |
DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" | ||
173 | I | E | b | 0.0 | 3cdg_G | IVLTAHMY |
DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" | ||
174 | C | E | b | 0.0 | 3cdg_G | CL |
DISULFID ECO:0000269|PubMed:18083576, ECO:0000269|PubMed:18332182, ECO:0000269|PubMed:18448674" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DISULFID ECO:0000269|PubMed:18083576, ECO:0000269|PubMed:18332182, ECO:0000269|PubMed:18448674" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" | ||
175 | K | E | b | 5.7 | 3cdg_G | KEQSAMRVGN |
DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" DOMAIN /note="C-type lectin" TOPO_DOM /note="Extracellular" | ||
176 | Q | E | b | 15.3 | 3cdg_G | KRFMQTHAESILY |
TOPO_DOM /note="Extracellular" TOPO_DOM /note="Extracellular" | ||
177 | Q | e | 50.0 | 3cdg_G | KERQPTDGSIVYMN |
TOPO_DOM /note="Extracellular" TOPO_DOM /note="Extracellular" | |||
178 | L | e | 30.9 | 3cdg_G | LVKAIMTYDF |
TOPO_DOM /note="Extracellular" TOPO_DOM /note="Extracellular" | |||
179 | I | e | 102.9 | 3cdg_G | IVML |
TOPO_DOM /note="Extracellular" TOPO_DOM /note="Extracellular" |