Contact Molecules for Homologous Proteins | ||||
![]() [Summary Bars] |
![]() [Full Bars] |
|
![]() [Back to Search Page] |
![]() [Back to HOMCOS] |
![]() [SupCon3D] |
![]() [help] |
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100] | ![]() [show] [download] [help] |
PID | QueryLength | Homolgous Sequence in PDB | UniProt Query | TITLE |
2727836 | 179 | 596 | Q13241(KLRD1_HUMAN) | RecName: Full=Natural killer cells antigen CD94;AltName: Full=KP43;AltName: Full=Killer cell lectin-like receptor subfamily D member 1;AltName: Full=NK cell receptor;AltName: CD_antigen=CD94 ; |
QUERYSEQ |
MAVFKTTLWRLISGTLGIICLSLMSTLGILLKNSFTKLSIEPAFTPGPNIELQKDSDCCSCQEKWVGYRCNCYFISSEQKTWNESRHLCASQKSSLLQLQNTDELDFMSSSQQFYWIGLSYSEEHTAWLWENGSALSQYLFPSFETFNTK NCIAYNPNGNALDESCEDKNRYICKQQLI |
All | LB/B (likely benign or benign) | ||
Number of sites | 179 | 1 | |
Buired or Exposed | Buried | 43.6 (%) [65] | |
Exposed | 56.4 (%) [84] | ||
Ave relacc | 31.9 % | 0.0 % | |
SD relacc | 27.69 % | 0.00 % | |
Contact Mol | hetero | 64.2 (%) [115] | 0.0 (%) [0] |
nucleotide | 0.0 (%) [0] | 0.0 (%) [0] | |
compound | 41.9 (%) [75] | 0.0 (%) [0] | |
metal | 43.0 (%) [77] | 0.0 (%) [0] | |
otherpoly | 35.2 (%) [63] | 0.0 (%) [0] | |
homo | 67.0 (%) [120] | 0.0 (%) [0] | |
precipitant | 58.1 (%) [104] | 0.0 (%) [0] | |
Number of variants | 1 | 1 | |
N_Freq(AAvariant)==0 % | 0.0 % [0] | ||
N_Freq(AAvariant)>0 % | 100.0 % [1] | ||
Ave Freq(AAvariant) | 20.0 % | ||
SD Freq(AAvariant) | 0.00 % |
1 sites | 25 |
[n]:site number of query sequence. [a]:amino acid of query sequence. [s]:predicted secondary structure. [e]:predicted exposed/buried. [acc]:predicted relative accesssibility(%). [pdb]:PDB code of homologous structure. [contact_mols]:predicted binding molecules [observed aa]:Observed amino acids among homologous sequences. [feature table]:UniProt Feature Table [variant]:UniProt Human Variant.
n | a | s | e | acc | pdb | contact_mols | observed aa | feature table | variant |
![]() | S | - | - | - | - | VASTFGICKM |
TRANSMEM /note="Helical; Signal-anchor for type II membrane protein" TRANSMEM /note="Helical; Signal-anchor for type II membrane protein" DISORDER predicted by DISOPRED | S->A:(20.0 %):LB/B - dbSNP:rs1077225 |