[All Sites]

Contact Molecules for Homologous Proteins

[Summary Bars]
[Full Bars]


Sites by Variants[40 %]


[Back to Search Page]
[Back to HOMCOS]

[SupCon3D]
[help] 		seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
2727836 179 12 Q13241(KLRD1_HUMAN) RecName: Full=Natural killer cells antigen CD94;AltName: Full=KP43;AltName: Full=Killer cell lectin-like receptor subfamily D member 1;AltName: Full=NK cell receptor;AltName: CD_antigen=CD94 ;
QUERYSEQ 
MAVFKTTLWRLISGTLGIICLSLMSTLGILLKNSFTKLSIEPAFTPGPNIELQKDSDCCSCQEKWVGYRCNCYFISSEQKTWNESRHLCASQKSSLLQLQNTDELDFMSSSQQFYWIGLSYSEEHTAWLWENGSALSQYLFPSFETFNTK
NCIAYNPNGNALDESCEDKNRYICKQQLI
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

Statistics of sites in view of Disease classification

All LB/B (likely benign or benign)
Number of sites 179 1
Buired or ExposedBuried 39.8 (%) [49]
Exposed 60.2 (%) [74]
Ave relacc 33.7 % 0.0 %
SD relacc 26.95 % 0.00 %
Contact Molhetero 20.1 (%) [36] 0.0 (%) [0]
nucleotide 0.0 (%) [0] 0.0 (%) [0]
compound 0.0 (%) [0] 0.0 (%) [0]
metal 0.0 (%) [0] 0.0 (%) [0]
otherpoly 0.0 (%) [0] 0.0 (%) [0]
homo 0.0 (%) [0] 0.0 (%) [0]
precipitant 3.4 (%) [6] 0.0 (%) [0]
Number of variants 1 1
N_Freq(AAvariant)==0 % 0.0 % [0]
N_Freq(AAvariant)>0 % 100.0 % [1]
Ave Freq(AAvariant) 20.0 %
SD Freq(AAvariant) 0.00 %

Site Table for OMIM:LB/B [1 variants]

1 sites 25
  [n]:site number of query sequence.  [a]:amino acid of query sequence.  [s]:predicted secondary structure.
  [e]:predicted exposed/buried.  [acc]:predicted relative accesssibility(%).  [pdb]:PDB code of homologous structure.
  [contact_mols]:predicted binding molecules  [observed aa]:Observed amino acids among homologous sequences.  [feature table]:UniProt Feature Table
  [variant]:UniProt Human Variant.
n a s e acc pdb contact_mols observed aa feature table variant
25S---- 
VASTFGICKM
 TRANSMEM /note="Helical; Signal-anchor for type II membrane protein" TRANSMEM /note="Helical; Signal-anchor for type II membrane protein" DISORDER predicted by DISOPRED S->A:(20.0 %):LB/B - dbSNP:rs1077225