| PID |
QueryLength |
Homolgous Sequence in PDB |
UniProt Query |
TITLE |
| 2624989 |
215 |
82 |
P09429(HMGB1_HUMAN) |
RecName: Full=High mobility group protein B1;AltName: Full=High mobility group protein 1; Short=HMG-1; |
| QUERYSEQ |
MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAK
LKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEEDEEDEEDEEEEEDEEDEDEEEDDDDE
|
[BLAST file for PDB]
(plain)
(bar)
(multiple alignment)
[BLAST for UniProt:
(plain)
(bar)
(multiple alignment)
(PSSM file)
]
Statistics of sites in view of Disease classification
| All |
LB/B (likely benign or benign) | US (uncertain significance) |
| Number of sites |
215 |
1 |
3 |
| Buired or Exposed | Buried |
15.6 (%) [28] |
0.0 (%) [0] |
0.0 (%) [0] |
| Exposed |
84.4 (%) [152] |
100.0 (%) [1] |
100.0 (%) [2] |
| Ave relacc |
51.3 % |
44.2 % |
37.4 % |
| SD relacc |
27.48 % |
0.00 % |
13.54 % |
| Contact Mol | hetero |
20.0 (%) [43] |
100.0 (%) [1] |
33.3 (%) [1] |
| nucleotide |
42.8 (%) [92] |
100.0 (%) [1] |
33.3 (%) [1] |
| compound |
0.0 (%) [0] |
0.0 (%) [0] |
0.0 (%) [0] |
| metal |
0.5 (%) [1] |
0.0 (%) [0] |
0.0 (%) [0] |
| otherpoly |
0.0 (%) [0] |
0.0 (%) [0] |
0.0 (%) [0] |
| homo |
14.4 (%) [31] |
0.0 (%) [0] |
33.3 (%) [1] |
| precipitant |
15.3 (%) [33] |
0.0 (%) [0] |
0.0 (%) [0] |
| Number of variants |
4 |
1 |
3 |
| N_Freq(AAvariant)==0 % |
|
0.0 % [0] |
0.0 % [0] |
| N_Freq(AAvariant)>0 % |
|
100.0 % [1] |
100.0 % [3] |
| Ave Freq(AAvariant) |
|
7.0 % |
26.7 % |
| SD Freq(AAvariant) |
|
0.00 % |
18.55 % |
Site Table for OMIM:LB/B [1 variants]
[n]:site number of query sequence. [a]:amino acid of query sequence. [s]:predicted secondary structure.
[e]:predicted exposed/buried. [acc]:predicted relative accesssibility(%). [pdb]:PDB code of homologous structure.
[contact_mols]:predicted binding molecules [observed aa]:Observed amino acids among homologous sequences. [feature table]:UniProt Feature Table
[variant]:UniProt Human Variant.
| n |
a |
s |
e |
acc |
pdb |
contact_mols |
observed aa |
feature table |
variant |
 156 | E | H | e | 44.2 |  2yrq_A |
hetero RAGE_HUMAN nucleotide |
EKMDQNTYAGILFHR |
REGION /note="Binding to AGER/RAGE" DNA_BIND /note="HMG box 2" REGION /note="Binding to AGER/RAGE" DNA_BIND /note="HMG box 2" |
E->Q:(7.0 %):LB/B - |
Site Table for OMIM:US [3 variants]
[n]:site number of query sequence. [a]:amino acid of query sequence. [s]:predicted secondary structure.
[e]:predicted exposed/buried. [acc]:predicted relative accesssibility(%). [pdb]:PDB code of homologous structure.
[contact_mols]:predicted binding molecules [observed aa]:Observed amino acids among homologous sequences. [feature table]:UniProt Feature Table
[variant]:UniProt Human Variant.
| n |
a |
s |
e |
acc |
pdb |
contact_mols |
observed aa |
feature table |
variant |
| 11 | G | | e | 23.8 | 2yrq_A |
nucleotide |
RGAPHQSVDEFIKLNT |
SITE /note="Cleavage; by thrombin:thrombomodulin" REGION /note="LPS binding (delipidated)" DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" SITE /note="Cleavage; by thrombin:thrombomodulin" REGION /note="LPS binding (delipidated)" DISORDER predicted by DISOPRED DNA_BIND /note="HMG box 1" REGION /note="Sufficient for interaction with HAVCR2" |
G->R:(51.0 %):US Gastric-carcinoma cell line |
| 149 | A | H | e | 50.9 | 2yrq_A |
hetero RAGE_HUMAN homo |
AEQKSRDVNTGILM |
DNA_BIND /note="HMG box 2" DNA_BIND /note="HMG box 2" |
A->E:(23.0 %):US Gastric-carcinoma cell line |
| 190 | D | - | - | - | - |
|
DEKAG |
COMPBIAS /note="Acidic residues" REGION /note="Disordered" COMPBIAS /note="Acidic residues" DISORDER predicted by DISOPRED REGION /note="Disordered" |
D->G:(6.0 %):US Gastric-carcinoma cell line |
