Contact Molecules for Homologous Proteins | ||||
[Summary Bars] |
[Full Bars] |
|
[Back to Search Page] |
[Back to HOMCOS] |
[Sites by Variants] |
[SupCon3D] |
[help] |
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100] | [show] [download] [help] |
PID | QueryLength | Homolgous Sequence in PDB | UniProt Query | TITLE |
1956853 | 63 | 6 | P59634(NS6_SARS) | RecName: Full=ORF6 protein; Short=ORF6;AltName: Full=Accessory protein 6;AltName: Full=Non-structural protein 6; Short=ns6;AltName: Full=Protein X3; |
QUERYSEQ |
MFHLVDFQVTIAEILIIIMRTFRIAIWNLDVIISSIVRQLFKPLTKKNYSELDDEEPMELDYP |
[n]:site number of query sequence. [a]:amino acid of query sequence. [s]:predicted secondary structure. [e]:predicted exposed/buried. [acc]:predicted relative accesssibility(%). [pdb]:PDB code of homologous structure. [contact_mols]:predicted binding molecules [observed aa]:Observed amino acids among homologous sequences. [feature table]:UniProt Feature Table [variant]:UniProt Human Variant.
n | a | s | e | acc | pdb | contact_mols | observed aa | feature table | variant |
1 | M | - | - | - | - | M |
|||
2 | F | - | - | - | - | F |
|||
3 | H | - | - | - | - | H |
|||
4 | L | - | - | - | - | L |
|||
5 | V | - | - | - | - | V |
|||
6 | D | - | - | - | - | D |
|||
7 | F | - | - | - | - | F |
|||
8 | Q | - | - | - | - | Q |
|||
9 | V | - | - | - | - | V |
|||
10 | T | - | - | - | - | T |
|||
11 | I | - | - | - | - | I |
|||
12 | A | - | - | - | - | A |
|||
13 | E | - | - | - | - | E |
|||
14 | I | - | - | - | - | I |
|||
15 | L | - | - | - | - | L |
|||
16 | I | - | - | - | - | IL |
|||
17 | I | - | - | - | - | I |
|||
18 | I | - | - | - | - | I |
|||
19 | M | - | - | - | - | M |
|||
20 | R | - | - | - | - | RK |
|||
21 | T | - | - | - | - | T |
|||
22 | F | - | - | - | - | F |
|||
23 | R | - | - | - | - | RK |
|||
24 | I | - | - | - | - | VI |
|||
25 | A | - | - | - | - | AS |
|||
26 | I | - | - | - | - | I |
|||
27 | W | - | - | - | - | W |
|||
28 | N | - | - | - | - | N |
|||
29 | L | - | - | - | - | L |
|||
30 | D | - | - | - | - | D |
|||
31 | V | - | - | - | - | YIV |
|||
32 | I | - | - | - | - | IL |
|||
33 | I | - | - | - | - | I |
|||
34 | S | - | - | - | - | SN |
|||
35 | S | - | - | - | - | SL |
|||
36 | I | - | - | - | - | I |
|||
37 | V | - | - | - | - | VI |
|||
38 | R | - | - | - | - | RK |
|||
39 | Q | - | - | - | - | QN |
|||
40 | L | - | - | - | - | L |
|||
41 | F | - | - | - | - | FS |
|||
42 | K | - | - | - | - | K |
|||
43 | P | - | - | - | - | PS |
|||
44 | L | - | - | - | - | L |
|||
45 | T | - | - | - | - | T |
|||
46 | K | - | - | - | - | KE |
|||
47 | K | - | - | - | - | KN |
|||
48 | N | - | - | - | - | NK |
|||
49 | Y | - | - | - | - | Y |
MUTAGEN /note="YSEL->AAAA: No effect in the suppression of nuclear gene expression." MUTAGEN /note="YSEL->AAAA: No effect in the suppression of nuclear gene expression." | ||
50 | S | e | 131.2 | 7vpg_I | S |
MUTAGEN /note="YSEL->AAAA: No effect in the suppression of nuclear gene expression." MUTAGEN /note="YSEL->AAAA: No effect in the suppression of nuclear gene expression." | |||
51 | E | e | 85.4 | 7vpg_I | EQ |
MUTAGEN /note="YSEL->AAAA: No effect in the suppression of nuclear gene expression." MUTAGEN /note="YSEL->AAAA: No effect in the suppression of nuclear gene expression." | |||
52 | L | e | 91.0 | 7vpg_I | hetero RAE1L_HUMAN | L |
MUTAGEN /note="YSEL->AAAA: No effect in the suppression of nuclear gene expression." MUTAGEN /note="YSEL->AAAA: No effect in the suppression of nuclear gene expression." | ||
53 | D | e | 130.9 | 7f90_A | hetero RAE1L_HUMAN | D |
MUTAGEN /note="DDEE->AAAA: Reduction in the suppression of nuclear gene expression." MUTAGEN /note="DDEE->AAAA: Reduction in the suppression of nuclear gene expression." | ||
54 | D | e | 92.6 | 7f90_A | hetero RAE1L_HUMAN | DE |
MUTAGEN /note="DDEE->AAAA: Reduction in the suppression of nuclear gene expression." REGION /note="Critical for disrupting nuclear import" MUTAGEN /note="DDEE->AAAA: Reduction in the suppression of nuclear gene expression." REGION /note="Critical for disrupting nuclear import" | ||
55 | E | e | 98.5 | 7f90_A | hetero RAE1L_HUMAN | E |
MUTAGEN /note="DDEE->AAAA: Reduction in the suppression of nuclear gene expression." REGION /note="Critical for disrupting nuclear import" MUTAGEN /note="DDEE->AAAA: Reduction in the suppression of nuclear gene expression." REGION /note="Critical for disrupting nuclear import" | ||
56 | E | e | 82.9 | 7f90_A | hetero RAE1L_HUMAN | EQ |
MUTAGEN /note="DDEE->AAAA: Reduction in the suppression of nuclear gene expression." REGION /note="Critical for disrupting nuclear import" MUTAGEN /note="DDEE->AAAA: Reduction in the suppression of nuclear gene expression." REGION /note="Critical for disrupting nuclear import" | ||
57 | P | e | 97.7 | 7f90_A | hetero RAE1L_HUMAN | P |
REGION /note="Critical for disrupting nuclear import" REGION /note="Critical for disrupting nuclear import" | ||
58 | M | e | 72.0 | 7f90_A | hetero RAE1L_HUMAN | M |
MUTAGEN /note="M->A: Decreases down-regulation of protein expression of newly transcribed genes in the host cell. Complete loss of RAE1 binding." ECO:0000269|PubMed:35096974" REGION /note="Critical for disrupting nuclear import" MUTAGEN /note="M->A: Decreases down-regulation of protein expression of newly transcribed genes in the host cell. Complete loss of RAE1 binding." ECO:0000269|PubMed:35096974" REGION /note="Critical for disrupting nuclear import" | ||
59 | E | e | 100.0 | 7f90_A | hetero RAE1L_HUMAN NUP98_HUMAN | E |
REGION /note="Critical for disrupting nuclear import" REGION /note="Critical for disrupting nuclear import" | ||
60 | L | e | 81.5 | 7f90_A | hetero RAE1L_HUMAN | LI |
REGION /note="Critical for disrupting nuclear import" REGION /note="Critical for disrupting nuclear import" | ||
61 | D | e | 99.4 | 7f90_A | hetero RAE1L_HUMAN | D |
REGION /note="Critical for disrupting nuclear import" REGION /note="Critical for disrupting nuclear import" | ||
62 | Y | e | 110.9 | 7f90_A | hetero RAE1L_HUMAN | Y |
REGION /note="Critical for disrupting nuclear import" REGION /note="Critical for disrupting nuclear import" | ||
63 | P | e | 124.0 | 7f90_B | P |
REGION /note="Critical for disrupting nuclear import" REGION /note="Critical for disrupting nuclear import" |