[All Sites]

Contact Molecules for Homologous Proteins


[Summary Bars]

[Full Bars]


Sites by Variants[60 %]


[Back to Search Page]

[Back to HOMCOS]

[SupCon3D]

[help]
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]
[show] [download] [help]
PID QueryLength Homolgous Sequence in PDB UniProt Query TITLE
1551527 272 0 P35232(PHB1_HUMAN) RecName: Full=Prohibitin 1 ;
QUERYSEQ
MAAKVFESIGKFGLALAVAGGVVNSALYNVDAGHRAVIFDRFRGVQDIVVGEGTHFLIPWVQKPIIFDCRSRPRNVPVITGSKDLQNVNITLRILFRPVASQLPRIFTSIGEDYDERVLPSITTEILKSVVARFDAGELITQRELVSRQV
SDDLTERAATFGLILDDVSLTHLTFGKEFTEAVEAKQVAQQEAERARFVVEKAEQQKKAAIISAEGDSKAAELIANSLATAGDGLIELRKLEAAEDIAYQLSRSRNITYLPAGQSVLLQLPQ
[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

Statistics of sites in view of Disease classification

All US (uncertain significance)
Number of sites 272 2
Ave relacc 0.0 % 0.0 %
SD relacc 0.00 % 0.00 %
Contact Molhetero 0.0 (%) [0] 0.0 (%) [0]
nucleotide 0.0 (%) [0] 0.0 (%) [0]
compound 0.0 (%) [0] 0.0 (%) [0]
metal 0.0 (%) [0] 0.0 (%) [0]
otherpoly 0.0 (%) [0] 0.0 (%) [0]
homo 0.0 (%) [0] 0.0 (%) [0]
precipitant 0.0 (%) [0] 0.0 (%) [0]
Number of variants 2 2
N_Freq(AAvariant)==0 % 50.0 % [1]
N_Freq(AAvariant)>0 % 50.0 % [1]
Ave Freq(AAvariant) 1.5 %
SD Freq(AAvariant) 1.50 %

Site Table for OMIM:US [2 variants]

2 sites 88,105
  [n]:site number of query sequence.  [a]:amino acid of query sequence.  [s]:predicted secondary structure.
  [e]:predicted exposed/buried.  [acc]:predicted relative accesssibility(%).  [pdb]:PDB code of homologous structure.
  [contact_mols]:predicted binding molecules  [observed aa]:Observed amino acids among homologous sequences.  [feature table]:UniProt Feature Table
  [variant]:UniProt Human Variant.
n a s e acc pdb contact_mols observed aa feature table variant
88V----
V
V->A:(0.0 %):US A breast cancer sample dbSNP:rs1219183
105R----
EKRNSAQYFHTDGILPV
R->H:(3.0 %):US A breast cancer sample dbSNP:rs1219183