Contact Molecules for Homologous Proteins | ||||
![]() [Summary Bars] |
![]() [Full Bars] |
|
![]() [Back to Search Page] |
![]() [Back to HOMCOS] |
![]() [SupCon3D] |
![]() [help] |
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100] | ![]() [show] [download] [help] |
PID | QueryLength | Homolgous Sequence in PDB | UniProt Query | TITLE |
1551527 | 272 | 0 | P35232(PHB1_HUMAN) | RecName: Full=Prohibitin 1 ; |
QUERYSEQ |
MAAKVFESIGKFGLALAVAGGVVNSALYNVDAGHRAVIFDRFRGVQDIVVGEGTHFLIPWVQKPIIFDCRSRPRNVPVITGSKDLQNVNITLRILFRPVASQLPRIFTSIGEDYDERVLPSITTEILKSVVARFDAGELITQRELVSRQV SDDLTERAATFGLILDDVSLTHLTFGKEFTEAVEAKQVAQQEAERARFVVEKAEQQKKAAIISAEGDSKAAELIANSLATAGDGLIELRKLEAAEDIAYQLSRSRNITYLPAGQSVLLQLPQ |
All | US (uncertain significance) | ||
Number of sites | 272 | 2 | |
Ave relacc | 0.0 % | 0.0 % | |
SD relacc | 0.00 % | 0.00 % | |
Contact Mol | hetero | 0.0 (%) [0] | 0.0 (%) [0] |
nucleotide | 0.0 (%) [0] | 0.0 (%) [0] | |
compound | 0.0 (%) [0] | 0.0 (%) [0] | |
metal | 0.0 (%) [0] | 0.0 (%) [0] | |
otherpoly | 0.0 (%) [0] | 0.0 (%) [0] | |
homo | 0.0 (%) [0] | 0.0 (%) [0] | |
precipitant | 0.0 (%) [0] | 0.0 (%) [0] | |
Number of variants | 2 | 2 | |
N_Freq(AAvariant)==0 % | 50.0 % [1] | ||
N_Freq(AAvariant)>0 % | 50.0 % [1] | ||
Ave Freq(AAvariant) | 1.5 % | ||
SD Freq(AAvariant) | 1.50 % |
2 sites | 88,105 |
[n]:site number of query sequence. [a]:amino acid of query sequence. [s]:predicted secondary structure. [e]:predicted exposed/buried. [acc]:predicted relative accesssibility(%). [pdb]:PDB code of homologous structure. [contact_mols]:predicted binding molecules [observed aa]:Observed amino acids among homologous sequences. [feature table]:UniProt Feature Table [variant]:UniProt Human Variant.
n | a | s | e | acc | pdb | contact_mols | observed aa | feature table | variant |
![]() | V | - | - | - | - | V |
V->A:(0.0 %):US A breast cancer sample dbSNP:rs1219183 | ||
![]() | R | - | - | - | - | EKRNSAQYFHTDGILPV |
R->H:(3.0 %):US A breast cancer sample dbSNP:rs1219183 |