HOMCOS(prot_sch_conbars.cgi):

#WARNING:no index is registered index "YP_009725299.1" in "https://rest.uniprot.org/uniprotkb/" url "https://rest.uniprot.org/uniprotkb/YP_009725299.1.txt".
Please visit the UniProt website(https://www.uniprot.org), and get a proper ID/AC for your query protein.

		Contact Molecules for Homologous Proteins
[Full Bars]	[SiteTable]	Summary Bars[100 %]	[Back to Search Page]	[Back to HOMCOS]
[SupCon3D]	[help]	seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]	[show] [download] [help]

PID

QueryLength

Homolgous Sequence in PDB

UniProt Query

TITLE

13602

1945

416

YP_009725299.1()

QUERYSEQ

APTKVTFGDDTVIEVQGYKSVNITFELDERIDKVLNEKCSAYTVELGTEVNEFACVVADAVIKTLQPVSELLTPLGIDLDEWSMATYYLFDESGEFKLASHMYCSFYPPDEDEEEGDCEEEEFEPSTQYEYGTEDDYQGKPLEFGATSAA
LQPEEEQEEDWLDDDSQQTVGQQDGSEDNQTTTIQTIVEVQPQLEMELTPVVQTIEVNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQVESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVV
GPNVNKGEDIQLLKSAYENFNQHEVLLAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFLEMKSEKQVEQKIAEIPKEEVKPFITESKPSVEQRKQDDKKIKACVEEVTTTLEETKFLTENLLLYIDINGNLHPDSA
TLVSDIDITFLKKDAPYIVGDVVQEGVLTAVVIPTKKAGGTTEMLAKALRKVPTDNYITTYPGQGLNGYTVEEAKTVLKKCKSAFYILPSIISNEKQEILGTVSWNLREMLAHAEETRKLMPVCVETKAIVSTIQRKYKGIKIQEGVVDY
GARFYFYTSKTTVASLINTLNDLNETLVTMPLGYVTHGLNLEEAARYMRSLKVPATVSVSSPDAVTAYNGYLTSSSKTPEEHFIETISLAGSYKDWSYSGQSTQLGIEFLKRGDKSVYYTSNPTTFHLDGEVITFDNLKTLLSLREVRTI
KVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYC
NKTVGELGDVRETMSYLFQHANLDSCKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPITDVFY
KENSYTTTIKPVTYKLDGVVCTEIDPKLDNYYKKDNSYFTEQPIDLVPNQPYPNASFDNFKFVCDNIKFADDLNQLTGYKKPASRELKVTFFPDLNGDVVAIDYKHYTPSFKKGAKLLHKPIVWHVNNATNKATYKPNTWCIRCLWSTKP
VETSNSFDVLKSEDAQGMDNLACEDLKPVSEEVVENPTIQKDVLECNVKTTEVVGDIILKPANNSLKITEEVGHTDLMAAYVDNSSLTIKKPNELSRVLGLKTLATHGLAAVNSVPWDTIANYAKPFLNKVVSTTTNIVTRCLNRVCTNY
MPYFFTLLLQLCTFTRSTNSRIKASMPTTIAKNTVKSVGKFCLEASFNYLKSPNFSKLINIIIWFLLLSVCLGSLIYSTAALGVLMSNLGMPSYCTGYREGYLNSTNVTIATYCTGSIPCSVCLSGLDSLDTYPSLETIQITISSFKWDL
TAFGLVAEWFLAYILFTRFFYVLGLAAIMQLFFSYFAVHFISNSWLMWLIINLVQMAPISAMVRMYIFFASFYYVWKSYVHVVDGCNSSTCMMCYKRNRATRVECTTIVNGVRRSFYVYANGGKGFCKLHNWNCVNCDTFCAGSTFISDE
VARDLSLQFKRPINPTDQSSYIVDSVTVKNGSIHLYFDKAGQKTYERHSLSHFVNLDNLRANNTKGSLPINVIVFDGKSKCEESSAKSASVYYSQLMCQPILLLDQALVSDVGDSAEVAVKMFDAYVNTFSSTFNVPMEKLKTLVATAEA
ELAKNVSLDNVLSTFISAARQGFVDSDVETKDVVECLKLSHQSDIEVTGDSCNNYMLTYNKVENMTPRDLGACIDCSARHINAQVAKSHNIALIWNVKDFMSLSEQLRKQIRSAAKKNNLPFKLTCATTRQVVNVVTTKIALKGG

[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [YP_009725299.1()]

1945
	region	name	description
	1-1945	DISORDER	predicted by DISOPRED

MONOMER

1945

pdb_id a¹ identity[%]² description

7llf A 100.0 R1A_SARS2 Non-structural protein 3

8f2e A 100.0 R1AB_SARS2 Papain-like protease nsp3

6z72 A 100.0 R1AB_SARS2 Replicase polyprotein 1ab

1.a¹:asym_id for the homologue. 2.identity[%]²:sequence identity between the query and the homologue.

HETERO

1945 pdb_id contact mol homologue

a³ description a⁴ identity[%]⁵ Ncon⁶ description

6xa9[3] B ISG15_HUMAN ISG15 CTD-propargylamide[80 aa] A 100.0
/100.0 22
/22 R1AB_SARS2 Non-structural protein 3

6xaa[1] B J3QS39_HUMAN Ubiquitin-propargylamide[76 aa] A 100.0
/100.0 25
/25 R1AB_SARS2 Non-structural protein 3

8cx9[8] G RL40_HUMAN Ubiquitin variant UbV.CV2.1[75 aa] A 100.0
/100.0 12
/12 R1A_SARS2 Papain-like protease nsp3

8iho[2] C covalent inhibitor[4 aa] A 100.0
/100.0 18
/18 R1A_SARS2 Papain-like protease nsp3

8iho[1] D covalent inhibitor[4 aa] A 100.0
/100.0 1
/1 R1A_SARS2 Papain-like protease nsp3

3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.

COMPOUND

1945 pdb_id contact mol homologue

a³ description a⁴ identity[%]⁵ Ncon⁶ description

5rv9[1] D EKZ
4-tert-butylbenzene-1,2-diol[12 atoms] B 100.0
/100.0 5
/5 R1AB_SARS2 Non-structural protein 3

5rvi[1] D CLW
CHLORZOXAZONE[11 atoms] B 100.0
/100.0 5
/5 R1AB_SARS2 Non-structural protein 3

5rvj[1] B 4JQ
6-amino-2H-chromen-2-one[12 atoms] A 100.0
/100.0 6
/6 R1AB_SARS2 Non-structural protein 3

5rvk[1] B 2AK
7-bromo-5-methyl-1H-indole-2,3-dione[13 atoms] A 100.0
/100.0 6
/6 R1AB_SARS2 Non-structural protein 3

5rvl[1] B BVF
4-METHYLPYRIDIN-2-AMINE[8 atoms] A 100.0
/100.0 6
/6 R1AB_SARS2 Non-structural protein 3

5rvm[1] B HBD
4-HYDROXYBENZAMIDE[10 atoms] A 100.0
/100.0 6
/6 R1AB_SARS2 Non-structural protein 3

5rvn[1] B ANN
4-METHOXYBENZOIC ACID[11 atoms] A 100.0
/100.0 5
/5 R1AB_SARS2 Non-structural protein 3

5rvo[1] B AQO
2-AMINOQUINAZOLIN-4(3H)-ONE[12 atoms] A 100.0
/100.0 5
/5 R1AB_SARS2 Non-structural protein 3

5rvp[1] B 1SQ
ISOQUINOLIN-1-AMINE[11 atoms] A 100.0
/100.0 6
/6 R1AB_SARS2 Non-structural protein 3

5rvq[1] B 4BY
5-methyl-1H-indole-2-carboxylic acid[13 atoms] A 100.0
/100.0 8
/8 R1AB_SARS2 Non-structural protein 3

5rvr[1] B LZ1
1H-indazole[9 atoms] A 100.0
/100.0 4
/4 R1AB_SARS2 Non-structural protein 3

5rvs[1] B 0LO
5-phenylpyridine-3-carboxylic acid[15 atoms] A 100.0
/100.0 7
/7 R1AB_SARS2 Non-structural protein 3

5rvt[1] B 4BL
6-methyl-1H-indole-2-carboxylic acid[13 atoms] A 100.0
/100.0 6
/6 R1AB_SARS2 Non-structural protein 3

5rvu[1] B 6P3
6-phenylpyridine-3-carboxylic acid[15 atoms] A 100.0
/100.0 8
/8 R1AB_SARS2 Non-structural protein 3

5rvv[1] B WB1
6-methyl-1H-indole-3-carboxylic acid[13 atoms] A 100.0
/100.0 9
/9 R1AB_SARS2 Non-structural protein 3

5s1a[1] D WPS
5-amino-3-methyl-1H-pyrazole-4-carbonitrile[9 atom.. B 100.0
/100.0 6
/6 R1AB_SARS2 Non-structural protein 3

5s27[1] C WSM
4-(3-aminopropyl)-2H-1,4-benzoxazin-3(4H)-one[15 a.. B 100.0
/100.0 6
/6 R1AB_SARS2 Non-structural protein 3

5s2d[1] C U0P
N'-cyclopropyl-N-methyl-N-[(5-methyl-1,2-oxazol-3-.. B 100.0
/100.0 5
/5 R1AB_SARS2 Non-structural protein 3

5s2h[1] C VWV
ethyl (1,1-dioxo-1lambda~6~,4-thiazinan-4-yl)aceta.. B 100.0
/100.0 7
/7 R1AB_SARS2 Non-structural protein 3

5s2i[1] C LUY
~{N}-(2-phenylethyl)-1~{H}-benzimidazol-2-amine[18.. B 100.0
/100.0 7
/7 R1AB_SARS2 Non-structural protein 3

5s2j[1] C JGG
N-[(4-cyanophenyl)methyl]morpholine-4-carboxamide[.. B 100.0
/100.0 6
/6 R1AB_SARS2 Non-structural protein 3

5s2l[1] D VZS
N-(2-methoxy-5-methylphenyl)-N'-4H-1,2,4-triazol-4.. B 100.0
/100.0 5
/5 R1AB_SARS2 Non-structural protein 3

5s2u[1] C VXD
N-(3-chloro-2-methylphenyl)glycinamide[13 atoms] B 100.0
/100.0 4
/4 R1AB_SARS2 Non-structural protein 3

5s2v[1] C W0G
(3R)-1-(2-fluorophenyl)-3-(methylamino)pyrrolidin-.. B 100.0
/100.0 4
/4 R1AB_SARS2 Non-structural protein 3

5s2x[1] C W0J
(3R)-N-methyl-1-(pyridazin-3-yl)piperidin-3-amine[.. B 100.0
/100.0 5
/5 R1AB_SARS2 Non-structural protein 3

5s2y[1] C W0M
(2R)-2-(4-chlorophenoxy)propanamide[13 atoms] B 100.0
/100.0 5
/5 R1AB_SARS2 Non-structural protein 3

5s31[1] C W0S
1-(3,4,5-trimethoxyphenyl)methanamine[14 atoms] B 100.0
/100.0 5
/5 R1AB_SARS2 Non-structural protein 3

5s36[1] D 7ZC
1-(5-methoxy-1H-indol-3-yl)-N,N-dimethyl-methanami.. B 100.0
/100.0 6
/6 R1AB_SARS2 Non-structural protein 3

5s3i[1] C W1P
5-methyl-2-phenyl-2,4-dihydro-3H-pyrazol-3-one[13 .. B 100.0
/100.0 6
/6 R1AB_SARS2 Non-structural protein 3

5s3q[1] D W2A
(2R,3R)-2-methyl-1-(methylsulfonyl)piperidine-3-ca.. B 100.0
/100.0 4
/4 R1AB_SARS2 Non-structural protein 3

5s3q[1] E W2A
(2R,3R)-2-methyl-1-(methylsulfonyl)piperidine-3-ca.. B 100.0
/100.0 3
/3 R1AB_SARS2 Non-structural protein 3

5s3r[1] C W24
(2S,3S)-N,2-dimethyl-1-(methylsulfonyl)piperidine-.. B 100.0
/100.0 6
/6 R1AB_SARS2 Non-structural protein 3

5s3t[1] E W2G
(1R,2S)-2-(thiophen-3-yl)cyclopentane-1-carboxylic.. B 100.0
/100.0 5
/5 R1AB_SARS2 Non-structural protein 3

5s3v[1] C W2M
(2R)-1',4'-dihydro-2'H-spiro[pyrrolidine-2,3'-quin.. B 100.0
/100.0 6
/6 R1AB_SARS2 Non-structural protein 3

5s3w[1] C W2S
(3R,4R)-4-(2-methylphenyl)oxolane-3-carboxylic aci.. B 100.0
/100.0 5
/5 R1AB_SARS2 Non-structural protein 3

5s3y[1] C W2Y
(2S,3S)-2-methyl-1-(methylsulfonyl)piperidine-3-ca.. B 100.0
/100.0 7
/7 R1AB_SARS2 Non-structural protein 3

5s43[1] C UUJ
5-bromo-2-hydroxybenzonitrile[10 atoms] B 100.0
/100.0 6
/6 R1AB_SARS2 Non-structural protein 3

5s4k[1] C W44
(2S,5R,6R)-7-methyl-2,3,4,5,6,7-hexahydro-1H-2,6-m.. B 100.0
/100.0 6
/6 R1AB_SARS2 Non-structural protein 3

6w6y[1] C AMP
ADENOSINE MONOPHOSPHATE[23 atoms] A 100.0
/100.0 16
/16 R1AB_SARS2 Non-structural protein 3

6woj[15] E APR
ADENOSINE-5-DIPHOSPHORIBOSE[36 atoms] A 100.0
/100.0 21
/21 R1AB_SARS2 Non-structural protein 3

6z6i[5] E A1R
5'-O-[(S)-{[(S)-{[(2R,3R,4S)-3,4-DIHYDROXYPYRROLID.. A 100.0
/100.0 22
/22 R1AB_SARS2 Replicase polyprotein 1ab

6z6i[1] X A1R
5'-O-[(S)-{[(S)-{[(2R,3R,4S)-3,4-DIHYDROXYPYRROLID.. C 100.0
/100.0 5
/5 R1AB_SARS2 Replicase polyprotein 1ab

6z6i[1] O MPO
3[N-MORPHOLINO]PROPANE SULFONIC ACID[13 atoms] B 100.0
/100.0 3
/3 R1AB_SARS2 Replicase polyprotein 1ab

8azc[1] C MPO
3[N-MORPHOLINO]PROPANE SULFONIC ACID[13 atoms] A 100.0
/100.0 3
/3 R1A_SARS2 Papain-like protease nsp3

6z72[4] E A3R
Adenosine Diphosphate (Hydroxymethyl)pyrrolidine m.. A 100.0
/100.0 23
/23 R1AB_SARS2 Replicase polyprotein 1ab

6z72[1] R MLT
D-MALATE[9 atoms] D 100.0
/100.0 3
/3 R1AB_SARS2 Replicase polyprotein 1ab

7bf3[2] I ADN
ADENOSINE[19 atoms] A 100.0
/100.0 11
/11 R1AB_SARS2 NSP3 macrodomain

7bf4[1] B 5GP
GUANOSINE-5'-MONOPHOSPHATE[24 atoms] A 100.0
/100.0 7
/7 R1AB_SARS2 NSP3 macrodomain

7bf5[4] G A2R
[(2R,3R,4R,5R)-5-(6-AMINO-9H-PURIN-9-YL)-3-HYDROXY.. A 100.0
/100.0 23
/23 R1AB_SARS2 NSP3 macrodomain

7bf6[4] D U08
(2~{R},3~{R},4~{S},5~{R})-2-(4-azanylpyrrolo[2,1-f.. A 100.0
/100.0 13
/13 R1AB_SARS2 Papain-like protease nsp3

7cmd[6] E TTT
5-amino-2-methyl-N-[(1R)-1-naphthalen-1-ylethyl]be.. A 100.0
/100.0 10
/10 R1AB_SARS2 Non-structural protein 3

7jiw[1] B VBY
5-(acryloylamino)-2-methyl-N-[(1R)-1-(naphthalen-1.. A 100.0
/100.0 11
/11 R1A_SARS2 Papain-like protease

7jn2[1] B Y41
3-amino-2-methyl-N-[(1R)-1-(naphthalen-1-yl)ethyl].. A 100.0
/100.0 9
/9 R1A_SARS2 Papain-like protease

7kol[1] B Y96
5-[(E)-(hydroxyimino)methyl]-2-methyl-N-[(1R)-1-(n.. A 100.0
/100.0 11
/11 R1A_SARS2 Papain-like protease

7lbr[2] F XT7
5-[(azetidin-3-yl)amino]-N-[(1R)-1-{3-[5-({[(1S,3R.. A 100.0
/100.0 11
/11 R1A_SARS2 Non-structural protein 3

7lbs[2] C XR8
5-[(azetidin-3-yl)amino]-2-methyl-N-[(1R)-1-(3-{5-.. A 100.0
/100.0 12
/12 R1A_SARS2 Non-structural protein 3

7llf[2] I Y54
5-[(azetidin-3-yl)amino]-N-[(1R)-1-{3-[5-({[(1R,3S.. A 100.0
/100.0 11
/11 R1A_SARS2 Non-structural protein 3

7llz[2] C Y61
N-[(1R)-1-(3-{5-[(acetylamino)methyl]thiophen-2-yl.. A 100.0
/100.0 11
/11 R1A_SARS2 Non-structural protein 3

7los[2] E Y97
5-(azetidin-3-ylamino)-2-methyl-~{N}-[(1~{R})-1-[3.. A 100.0
/100.0 11
/11 R1A_SARS2 Non-structural protein 3

7nt4[4] C PRL
PROFLAVIN[16 atoms] A 100.0
/100.0 5
/5 R1AB_SARS2 Non-structural protein 3

7nt4[2] E PRL
PROFLAVIN[16 atoms] A 100.0
/100.0 5
/5 R1AB_SARS2 Non-structural protein 3

7ofs[1] E YRL
4-(2-hydroxyethyl)phenol[10 atoms] A 100.0
/100.0 10
/10 R1A_SARS2 Papain-like protease nsp3

7oft[1] K HBA
P-HYDROXYBENZALDEHYDE[9 atoms] A 100.0
/100.0 9
/9 R1A_SARS2 Papain-like protease nsp3

7ofu[1] B HE9
methyl 3,4-bis(oxidanyl)benzoate[12 atoms] A 100.0
/100.0 3
/3 R1A_SARS2 Papain-like protease nsp3

7qcg[1] B DZI
3,4,5-tris(oxidanyl)-N-[(E)-1H-pyrrol-2-ylmethylid.. A 100.0
/100.0 7
/7 R1A_SARS2 Papain-like protease nsp3

7qch[1] B A5I
N-(3,5-dimetoxy-4-hydroxybenzyliden)thiosemicarbaz.. A 100.0
/100.0 10
/10 R1A_SARS2 Papain-like protease nsp3

7qci[1] B A6Q
N-(3,4-dihydroxybenzylidene)-thiosemicarbazone[16 .. A 100.0
/100.0 10
/10 R1A_SARS2 Papain-like protease nsp3

7qcj[1] F A4O
N-(2,4-dihydroxybenzylidene)-thiosemicarbazone[14 .. A 100.0
/100.0 10
/10 R1A_SARS2 Papain-like protease nsp3

7qck[1] B A7L
N-(2,5-dihydroxybenzylidene)-thiosemicarbazone[16 .. A 100.0
/100.0 9
/9 R1A_SARS2 Papain-like protease nsp3

7rzc[3] D JWX
(1R)-N-[(1H-indol-3-yl)methyl]-N-methyl-1-(naphtha.. A 100.0
/100.0 10
/10 R1A_SARS2 Non-structural protein 3

7sdr[3] D JW9
4-({methyl[(1R)-1-(naphthalen-1-yl)ethyl]amino}met.. A 100.0
/100.0 12
/12 R1A_SARS2 Non-structural protein 3

7sgw[1] B L30
N-(naphthalen-1-yl)pyridine-3-carboxamide[19 atoms.. A 100.0
/100.0 9
/9 R1A_SARS2 Non-structural protein 3

8azi[2] C OHR
2'-deoxyadenosine 5'-diphosphoribose [35 atoms] A 100.0
/100.0 22
/22 R1A_SARS2 Papain-like protease nsp3

8azl[2] C OI3
2'-deoxyadenosine 5'-fluoro-diphosphoribose [36 at.. A 100.0
/100.0 23
/23 R1A_SARS2 Papain-like protease nsp3

8azm[2] C OI6
8-bromoadenosine 5'-diphosphoribose [37 atoms] A 100.0
/100.0 22
/22 R1A_SARS2 Papain-like protease nsp3

8azo[2] C OIG
beta-ethyl-adenosine diphosphate[29 atoms] A 100.0
/100.0 14
/14 R1A_SARS2 Papain-like protease nsp3

8azp[2] C OH9
beta-methyl-adenosine diphosphate[28 atoms] A 100.0
/100.0 17
/17 R1A_SARS2 Papain-like protease nsp3

8eua[1] B WUK
methyl 4-{2-[3-(2-{[(1R)-1-(naphthalen-1-yl)ethyl].. A 100.0
/100.0 18
/18 R1AB_SARS2 Papain-like protease nsp3

8g62[3] E YOO
3-methoxy-5-(1-methylpiperidin-4-yl)-N-[4-(pyrroli.. A 100.0
/100.0 10
/10 R1A_SARS2 Non-structural protein 3

8g62[1] F YOO
3-methoxy-5-(1-methylpiperidin-4-yl)-N-[4-(pyrroli.. A 100.0
/100.0 10
/10 R1A_SARS2 Non-structural protein 3

8g62[2] M YOO
3-methoxy-5-(1-methylpiperidin-4-yl)-N-[4-(pyrroli.. A 100.0
/100.0 4
/4 R1A_SARS2 Non-structural protein 3

8gia[1] C ZJ3
[(2R,3S,4R,5R)-5-(6-amino-9H-purin-9-yl)-3,4-dihyd.. A 100.0
/100.0 23
/23 R1AB_SARS2 Non-structural protein 3

8uob[1] B XB5
5-[2-(dimethylamino)ethoxy]-N-{(1R)-1-[(3M,5P)-3-(.. A 100.0
/100.0 13
/13 R1A_SARS2 Papain-like protease nsp3

8uuf[1] B XWO
N-{(1R)-1-[(3M,5P)-3,5-bis(1-methyl-1H-pyrazol-4-y.. A 100.0
/100.0 13
/13 R1A_SARS2 Papain-like protease nsp3

8uug[1] B XXW
N-[(1R)-1-{(3M,5M)-3-[1-(difluoromethyl)-1H-pyrazo.. A 100.0
/100.0 14
/14 R1AB_SARS2 Papain-like protease nsp3

8uuh[1] B XYI
5-[2-(dimethylamino)ethoxy]-2-methyl-N-[(1R)-1-{(3.. A 100.0
/100.0 15
/15 R1A_SARS2 Papain-like protease nsp3

8uuu[1] B XYR
N-{(1R)-1-[(3P,5M)-3-[1-(difluoromethyl)-1H-pyrazo.. A 100.0
/100.0 15
/15 R1A_SARS2 Papain-like protease nsp3

8uuv[1] B Y2I
N-{(1R)-1-[(3P,5P)-3-(1-cyclopropyl-1H-pyrazol-4-y.. A 100.0
/100.0 15
/15 R1A_SARS2 Papain-like protease nsp3

8uuw[1] B Y2N
5-[2-(dimethylamino)ethoxy]-2-methyl-N-{(1R)-1-[(3.. A 100.0
/100.0 14
/14 R1A_SARS2 Papain-like protease nsp3

8uvm[4] E Y3R
ethyl 4-oxo-4-(2-{3-[2-({(1S)-1-[(3P)-3-(thiophen-.. A 100.0
/100.0 19
/19 R1AB_SARS2 Papain-like protease nsp3

3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.

METAL

1945 pdb_id contact mol homologue

a³ description a⁴ identity[%]⁵ Ncon⁶ description

6w9c[69] D ZN
ZINC ION[1 atoms] A 100.0
/100.0 4
/4 R1A_SARS2 Non-structural protein 3

6w9c[4] H ZN
ZINC ION[1 atoms] A 100.0
/100.0 2
/2 R1A_SARS2 Non-structural protein 3

7cmd[1] G ZN
ZINC ION[1 atoms] A 100.0
/100.0 1
/1 R1AB_SARS2 Non-structural protein 3

7cmd[1] J ZN
ZINC ION[1 atoms] B 100.0
/100.0 6
/6 R1AB_SARS2 Non-structural protein 3

7cmd[2] K ZN
ZINC ION[1 atoms] B 100.0
/100.0 4
/4 R1AB_SARS2 Non-structural protein 3

7cmd[1] L ZN
ZINC ION[1 atoms] B 100.0
/100.0 2
/2 R1AB_SARS2 Non-structural protein 3

7jiw[17] D ZN
ZINC ION[1 atoms] A 100.0
/100.0 2
/2 R1A_SARS2 Papain-like protease

7jiw[11] E ZN
ZINC ION[1 atoms] A 100.0
/100.0 1
/1 R1A_SARS2 Papain-like protease

7jiw[11] F ZN
ZINC ION[1 atoms] A 100.0
/100.0 2
/2 R1A_SARS2 Papain-like protease

7jn2[5] D ZN
ZINC ION[1 atoms] A 100.0
/100.0 4
/4 R1A_SARS2 Papain-like protease

8eua[1] D ZN
ZINC ION[1 atoms] A 100.0
/100.0 1
/1 R1AB_SARS2 Papain-like protease nsp3

8uuw[1] G ZN
ZINC ION[1 atoms] A 100.0
/100.0 1
/1 R1A_SARS2 Papain-like protease nsp3

8uuy[1] F ZN
ZINC ION[1 atoms] A 100.0
/100.0 2
/2 R1A_SARS2 Papain-like protease nsp3

8uuy[1] J ZN
ZINC ION[1 atoms] A 100.0
/100.0 1
/1 R1A_SARS2 Papain-like protease nsp3

6w9c[3] E CL
CHLORIDE ION[1 atoms] A 100.0
/100.0 7
/7 R1A_SARS2 Non-structural protein 3

6wen[1] B CL
CHLORIDE ION[1 atoms] A 100.0
/100.0 3
/3 R1AB_SARS2 Non-structural protein 3

6wzu[23] F CL
CHLORIDE ION[1 atoms] A 100.0
/100.0 3
/3 R1AB_SARS2 Non-structural protein 3

6wzu[6] G CL
CHLORIDE ION[1 atoms] A 100.0
/100.0 6
/6 R1AB_SARS2 Non-structural protein 3

7jiw[21] G CL
CHLORIDE ION[1 atoms] A 100.0
/100.0 4
/4 R1A_SARS2 Papain-like protease

7jiw[3] I CL
CHLORIDE ION[1 atoms] A 100.0
/100.0 5
/5 R1A_SARS2 Papain-like protease

7jiw[2] J CL
CHLORIDE ION[1 atoms] A 100.0
/100.0 2
/2 R1A_SARS2 Papain-like protease

7los[3] M CL
CHLORIDE ION[1 atoms] B 100.0
/100.0 1
/1 R1A_SARS2 Non-structural protein 3

7nfv[4] F CL
CHLORIDE ION[1 atoms] A 100.0
/100.0 4
/4 R1A_SARS2 Papain-like protease nsp3

7oft[1] E CL
CHLORIDE ION[1 atoms] A 100.0
/100.0 3
/3 R1A_SARS2 Papain-like protease nsp3

7oft[1] F CL
CHLORIDE ION[1 atoms] A 100.0
/100.0 2
/2 R1A_SARS2 Papain-like protease nsp3

7oft[1] H CL
CHLORIDE ION[1 atoms] A 100.0
/100.0 4
/4 R1A_SARS2 Papain-like protease nsp3

7oft[2] I CL
CHLORIDE ION[1 atoms] A 100.0
/100.0 2
/2 R1A_SARS2 Papain-like protease nsp3

7oft[1] J CL
CHLORIDE ION[1 atoms] A 100.0
/100.0 2
/2 R1A_SARS2 Papain-like protease nsp3

7qcj[3] L CL
CHLORIDE ION[1 atoms] A 100.0
/100.0 2
/2 R1A_SARS2 Papain-like protease nsp3

7qcj[1] N CL
CHLORIDE ION[1 atoms] A 100.0
/100.0 1
/1 R1A_SARS2 Papain-like protease nsp3

7qcj[1] O CL
CHLORIDE ION[1 atoms] A 100.0
/100.0 3
/3 R1A_SARS2 Papain-like protease nsp3

7qcm[2] J CL
CHLORIDE ION[1 atoms] A 100.0
/100.0 2
/2 R1A_SARS2 Papain-like protease nsp3

8cx9[1] W CL
CHLORIDE ION[1 atoms] D 100.0
/100.0 3
/3 R1A_SARS2 Papain-like protease nsp3

8fwo[1] H CL
CHLORIDE ION[1 atoms] A 100.0
/100.0 1
/1 R1AB_SARS2 Papain-like protease nsp3

8g62[9] I CL
CHLORIDE ION[1 atoms] A 100.0
/100.0 4
/4 R1A_SARS2 Non-structural protein 3

8ilc[1] G CL
CHLORIDE ION[1 atoms] A 100.0
/100.0 2
/2 R1A_SARS2 Papain-like protease nsp3

8ilc[1] H CL
CHLORIDE ION[1 atoms] A 100.0
/100.0 1
/1 R1A_SARS2 Papain-like protease nsp3

8uuf[1] I CL
CHLORIDE ION[1 atoms] A 100.0
/100.0 2
/2 R1A_SARS2 Papain-like protease nsp3

8uuv[1] I CL
CHLORIDE ION[1 atoms] A 100.0
/100.0 2
/2 R1A_SARS2 Papain-like protease nsp3

8uuw[1] K CL
CHLORIDE ION[1 atoms] A 100.0
/100.0 1
/1 R1A_SARS2 Papain-like protease nsp3

6ywk[4] I MG
MAGNESIUM ION[1 atoms] C 100.0
/100.0 1
/4 R1AB_SARS2 NSP3 macrodomain

7bf5[1] F MG
MAGNESIUM ION[1 atoms] A 100.0
/100.0 1
/1 R1AB_SARS2 NSP3 macrodomain

6z5t[6] D NA
SODIUM ION[1 atoms] A 100.0
/100.0 3
/3 R1AB_SARS2 Replicase polyprotein 1ab

6z6i[1] K NA
SODIUM ION[1 atoms] A 100.0
/100.0 3
/3 R1AB_SARS2 Replicase polyprotein 1ab

6z6i[1] L NA
SODIUM ION[1 atoms] A 100.0
/100.0 2
/2 R1AB_SARS2 Replicase polyprotein 1ab

6z6i[2] Q NA
SODIUM ION[1 atoms] B 100.0
/100.0 2
/2 R1AB_SARS2 Replicase polyprotein 1ab

6z6i[3] AA NA
SODIUM ION[1 atoms] C 100.0
/100.0 2
/2 R1AB_SARS2 Replicase polyprotein 1ab

6z6i[1] BA NA
SODIUM ION[1 atoms] C 100.0
/100.0 2
/2 R1AB_SARS2 Replicase polyprotein 1ab

6z6i[1] Z NA
SODIUM ION[1 atoms] C 100.0
/100.0 3
/3 R1AB_SARS2 Replicase polyprotein 1ab

6z6i[1] KA NA
SODIUM ION[1 atoms] D 100.0
/100.0 4
/4 R1AB_SARS2 Replicase polyprotein 1ab

8cx9[2] R NA
SODIUM ION[1 atoms] B 100.0
/100.0 2
/2 R1A_SARS2 Papain-like protease nsp3

7jn2[2] M UNX
UNKNOWN ATOM OR ION[1 atoms] A 100.0
/100.0 1
/1 R1A_SARS2 Papain-like protease

7oft[1] L K
POTASSIUM ION[1 atoms] A 100.0
/100.0 1
/1 R1A_SARS2 Papain-like protease nsp3

7oft[1] M K
POTASSIUM ION[1 atoms] A 100.0
/100.0 3
/3 R1A_SARS2 Papain-like protease nsp3

8cx9[1] N BR
BROMIDE ION[1 atoms] A 100.0
/100.0 3
/3 R1A_SARS2 Papain-like protease nsp3

8cx9[1] P BR
BROMIDE ION[1 atoms] B 100.0
/100.0 3
/3 R1A_SARS2 Papain-like protease nsp3

8cx9[1] Q BR
BROMIDE ION[1 atoms] B 100.0
/100.0 3
/3 R1A_SARS2 Papain-like protease nsp3

8cx9[1] V BR
BROMIDE ION[1 atoms] D 100.0
/100.0 3
/3 R1A_SARS2 Papain-like protease nsp3

3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.

HOMO

1945 pdb_id contact mol homologue

a³ description a⁴ identity[%]⁵ Ncon⁶ description

6w9c[8] B R1A_SARS2 Non-structural protein 3[307 aa] A 100.0
/100.0 5
/5 R1A_SARS2 Non-structural protein 3

3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.

PRECIPITANT

1945 pdb_id contact mol homologue

a³ description a⁴ identity[%]⁵ Ncon⁶ description

5s18[3] E DMS
DIMETHYL SULFOXIDE[4 atoms] B 100.0
/100.0 4
/4 R1AB_SARS2 Non-structural protein 3

8uuw[1] C DMS
DIMETHYL SULFOXIDE[4 atoms] A 100.0
/100.0 1
/1 R1A_SARS2 Papain-like protease nsp3

5s4g[1] E SO4
SULFATE ION[5 atoms] B 100.0
/100.0 3
/3 R1AB_SARS2 Non-structural protein 3

7jrn[1] E SO4
SULFATE ION[5 atoms] A 100.0
/100.0 2
/2 R1A_SARS2 Non-structural protein 3

7jrn[4] F SO4
SULFATE ION[5 atoms] A 100.0
/100.0 2
/2 R1A_SARS2 Non-structural protein 3

7jrn[10] I SO4
SULFATE ION[5 atoms] B 100.0
/100.0 3
/3 R1A_SARS2 Non-structural protein 3

7jrn[1] J SO4
SULFATE ION[5 atoms] B 100.0
/100.0 5
/5 R1A_SARS2 Non-structural protein 3

7lbr[10] D SO4
SULFATE ION[5 atoms] A 100.0
/100.0 5
/5 R1A_SARS2 Non-structural protein 3

7lbs[1] H SO4
SULFATE ION[5 atoms] A 100.0
/100.0 4
/4 R1A_SARS2 Non-structural protein 3

7llf[2] H SO4
SULFATE ION[5 atoms] A 100.0
/100.0 1
/1 R1A_SARS2 Non-structural protein 3

7llz[1] G SO4
SULFATE ION[5 atoms] A 100.0
/100.0 2
/2 R1A_SARS2 Non-structural protein 3

7llz[3] L SO4
SULFATE ION[5 atoms] B 100.0
/100.0 5
/5 R1A_SARS2 Non-structural protein 3

7nt4[1] K SO4
SULFATE ION[5 atoms] A 100.0
/100.0 4
/4 R1AB_SARS2 Non-structural protein 3

7nt4[1] T SO4
SULFATE ION[5 atoms] B 100.0
/100.0 3
/3 R1AB_SARS2 Non-structural protein 3

7nt4[2] U SO4
SULFATE ION[5 atoms] B 100.0
/100.0 2
/2 R1AB_SARS2 Non-structural protein 3

8eua[1] F SO4
SULFATE ION[5 atoms] A 100.0
/100.0 2
/2 R1AB_SARS2 Papain-like protease nsp3

8ilc[1] B SO4
SULFATE ION[5 atoms] A 100.0
/100.0 4
/4 R1A_SARS2 Papain-like protease nsp3

8ilc[1] C SO4
SULFATE ION[5 atoms] A 100.0
/100.0 1
/1 R1A_SARS2 Papain-like protease nsp3

8ilc[1] D SO4
SULFATE ION[5 atoms] A 100.0
/100.0 2
/2 R1A_SARS2 Papain-like protease nsp3

8ilc[1] E SO4
SULFATE ION[5 atoms] A 100.0
/100.0 3
/3 R1A_SARS2 Papain-like protease nsp3

8uvm[4] F SO4
SULFATE ION[5 atoms] A 100.0
/100.0 5
/5 R1AB_SARS2 Papain-like protease nsp3

5s74[2] E EDO
1,2-ETHANEDIOL[4 atoms] B 100.0
/100.0 2
/2 R1AB_SARS2 Non-structural protein 3

5s74[6] F EDO
1,2-ETHANEDIOL[4 atoms] B 100.0
/100.0 4
/4 R1AB_SARS2 Non-structural protein 3

5s74[2] G EDO
1,2-ETHANEDIOL[4 atoms] B 100.0
/100.0 6
/6 R1AB_SARS2 Non-structural protein 3

5s74[74] H EDO
1,2-ETHANEDIOL[4 atoms] B 100.0
/100.0 3
/3 R1AB_SARS2 Non-structural protein 3

6ywk[1] F EDO
1,2-ETHANEDIOL[4 atoms] A 100.0
/100.0 2
/2 R1AB_SARS2 NSP3 macrodomain

6ywk[10] K EDO
1,2-ETHANEDIOL[4 atoms] C 100.0
/100.0 6
/6 R1AB_SARS2 NSP3 macrodomain

6ywk[2] L EDO
1,2-ETHANEDIOL[4 atoms] C 100.0
/100.0 2
/3 R1AB_SARS2 NSP3 macrodomain

6ywk[3] M EDO
1,2-ETHANEDIOL[4 atoms] C 100.0
/100.0 2
/2 R1AB_SARS2 NSP3 macrodomain

6ywk[1] W EDO
1,2-ETHANEDIOL[4 atoms] D 100.0
/100.0 1
/1 R1AB_SARS2 NSP3 macrodomain

6ywk[1] Z EDO
1,2-ETHANEDIOL[4 atoms] D 100.0
/100.0 1
/1 R1AB_SARS2 NSP3 macrodomain

6ywl[5] H EDO
1,2-ETHANEDIOL[4 atoms] A 100.0
/100.0 6
/6 R1AB_SARS2 NSP3 macrodomain

6ywm[1] I EDO
1,2-ETHANEDIOL[4 atoms] A 100.0
/100.0 3
/3 R1AB_SARS2 NSP3 macrodomain

6z6i[1] IA EDO
1,2-ETHANEDIOL[4 atoms] D 100.0
/100.0 1
/1 R1AB_SARS2 Replicase polyprotein 1ab

6z72[1] G EDO
1,2-ETHANEDIOL[4 atoms] A 100.0
/100.0 4
/4 R1AB_SARS2 Replicase polyprotein 1ab

7bf6[1] E EDO
1,2-ETHANEDIOL[4 atoms] A 100.0
/100.0 3
/3 R1AB_SARS2 Papain-like protease nsp3

7nt4[8] F EDO
1,2-ETHANEDIOL[4 atoms] A 100.0
/100.0 11
/11 R1AB_SARS2 Non-structural protein 3

7nt4[1] H EDO
1,2-ETHANEDIOL[4 atoms] A 100.0
/100.0 3
/3 R1AB_SARS2 Non-structural protein 3

7nt4[1] I EDO
1,2-ETHANEDIOL[4 atoms] A 100.0
/100.0 6
/6 R1AB_SARS2 Non-structural protein 3

7nt4[1] P EDO
1,2-ETHANEDIOL[4 atoms] B 100.0
/100.0 3
/3 R1AB_SARS2 Non-structural protein 3

7nt4[1] R EDO
1,2-ETHANEDIOL[4 atoms] B 100.0
/100.0 4
/4 R1AB_SARS2 Non-structural protein 3

7rzc[2] O EDO
1,2-ETHANEDIOL[4 atoms] B 100.0
/100.0 5
/5 R1A_SARS2 Non-structural protein 3

6wzu[10] C GOL
GLYCEROL[6 atoms] A 100.0
/100.0 3
/3 R1AB_SARS2 Non-structural protein 3

6wzu[1] H GOL
GLYCEROL[6 atoms] A 100.0
/100.0 6
/6 R1AB_SARS2 Non-structural protein 3

6xa9[4] G GOL
GLYCEROL[6 atoms] A 100.0
/100.0 5
/5 R1AB_SARS2 Non-structural protein 3

6xa9[2] H GOL
GLYCEROL[6 atoms] A 100.0
/100.0 3
/3 R1AB_SARS2 Non-structural protein 3

6xa9[2] I GOL
GLYCEROL[6 atoms] A 100.0
/100.0 5
/5 R1AB_SARS2 Non-structural protein 3

6xa9[1] P GOL
GLYCEROL[6 atoms] E 100.0
/100.0 2
/2 R1AB_SARS2 Non-structural protein 3

6z6i[1] H GOL
GLYCEROL[6 atoms] A 100.0
/100.0 10
/10 R1AB_SARS2 Replicase polyprotein 1ab

6z6i[4] N GOL
GLYCEROL[6 atoms] B 100.0
/100.0 3
/3 R1AB_SARS2 Replicase polyprotein 1ab

6z6i[2] S GOL
GLYCEROL[6 atoms] C 100.0
/100.0 4
/4 R1AB_SARS2 Replicase polyprotein 1ab

7lbr[3] G GOL
GLYCEROL[6 atoms] A 100.0
/100.0 3
/3 R1A_SARS2 Non-structural protein 3

7lbr[2] L GOL
GLYCEROL[6 atoms] B 100.0
/100.0 4
/4 R1A_SARS2 Non-structural protein 3

7lbs[1] M GOL
GLYCEROL[6 atoms] B 100.0
/100.0 6
/6 R1A_SARS2 Non-structural protein 3

7lbs[1] N GOL
GLYCEROL[6 atoms] B 100.0
/100.0 6
/6 R1A_SARS2 Non-structural protein 3

7nfv[2] C GOL
GLYCEROL[6 atoms] A 100.0
/100.0 6
/6 R1A_SARS2 Papain-like protease nsp3

7ofu[8] D GOL
GLYCEROL[6 atoms] A 100.0
/100.0 7
/7 R1A_SARS2 Papain-like protease nsp3

7qcg[1] C GOL
GLYCEROL[6 atoms] A 100.0
/100.0 3
/3 R1A_SARS2 Papain-like protease nsp3

7qcj[2] E GOL
GLYCEROL[6 atoms] A 100.0
/100.0 3
/3 R1A_SARS2 Papain-like protease nsp3

8f2e[2] B GOL
GLYCEROL[6 atoms] A 100.0
/100.0 5
/5 R1AB_SARS2 Papain-like protease nsp3

8f2e[1] C GOL
GLYCEROL[6 atoms] A 100.0
/100.0 5
/5 R1AB_SARS2 Papain-like protease nsp3

8f2e[1] D GOL
GLYCEROL[6 atoms] A 100.0
/100.0 2
/2 R1AB_SARS2 Papain-like protease nsp3

8f2e[1] G GOL
GLYCEROL[6 atoms] A 100.0
/100.0 3
/3 R1AB_SARS2 Papain-like protease nsp3

8fwo[1] B GOL
GLYCEROL[6 atoms] A 100.0
/100.0 4
/4 R1AB_SARS2 Papain-like protease nsp3

8fwo[1] C GOL
GLYCEROL[6 atoms] A 100.0
/100.0 2
/2 R1AB_SARS2 Papain-like protease nsp3

8uuu[1] N GOL
GLYCEROL[6 atoms] A 100.0
/100.0 3
/3 R1A_SARS2 Papain-like protease nsp3

6wzu[1] D PO4
PHOSPHATE ION[5 atoms] A 100.0
/100.0 2
/2 R1AB_SARS2 Non-structural protein 3

6wzu[1] E PO4
PHOSPHATE ION[5 atoms] A 100.0
/100.0 5
/5 R1AB_SARS2 Non-structural protein 3

7nfv[10] E PO4
PHOSPHATE ION[5 atoms] A 100.0
/100.0 5
/5 R1A_SARS2 Papain-like protease nsp3

7ofu[3] G PO4
PHOSPHATE ION[5 atoms] A 100.0
/100.0 5
/5 R1A_SARS2 Papain-like protease nsp3

7ofu[3] H PO4
PHOSPHATE ION[5 atoms] A 100.0
/100.0 2
/2 R1A_SARS2 Papain-like protease nsp3

7ofu[6] I PO4
PHOSPHATE ION[5 atoms] A 100.0
/100.0 1
/1 R1A_SARS2 Papain-like protease nsp3

7qch[3] G PO4
PHOSPHATE ION[5 atoms] A 100.0
/100.0 2
/2 R1A_SARS2 Papain-like protease nsp3

7qci[1] I PO4
PHOSPHATE ION[5 atoms] A 100.0
/100.0 1
/1 R1A_SARS2 Papain-like protease nsp3

7qcj[2] J PO4
PHOSPHATE ION[5 atoms] A 100.0
/100.0 1
/1 R1A_SARS2 Papain-like protease nsp3

7qcj[1] K PO4
PHOSPHATE ION[5 atoms] A 100.0
/100.0 4
/4 R1A_SARS2 Papain-like protease nsp3

6ywk[2] J EPE
4-(2-HYDROXYETHYL)-1-PIPERAZINE ETHANESULFONIC ACI.. C 100.0
/100.0 6
/6 R1AB_SARS2 NSP3 macrodomain

6ywk[1] CA EPE
4-(2-HYDROXYETHYL)-1-PIPERAZINE ETHANESULFONIC ACI.. E 100.0
/100.0 11
/11 R1AB_SARS2 NSP3 macrodomain

6ywm[1] D MES
2-(N-MORPHOLINO)-ETHANESULFONIC ACID[12 atoms] A 100.0
/100.0 10
/10 R1AB_SARS2 NSP3 macrodomain

7jiw[2] K MES
2-(N-MORPHOLINO)-ETHANESULFONIC ACID[12 atoms] A 100.0
/100.0 6
/6 R1A_SARS2 Papain-like protease

7jn2[1] L ACT
ACETATE ION[4 atoms] A 100.0
/100.0 2
/2 R1A_SARS2 Papain-like protease

8g62[3] J ACT
ACETATE ION[4 atoms] A 100.0
/100.0 3
/3 R1A_SARS2 Non-structural protein 3

8g62[2] K ACT
ACETATE ION[4 atoms] A 100.0
/100.0 6
/6 R1A_SARS2 Non-structural protein 3

8g62[1] L ACT
ACETATE ION[4 atoms] A 100.0
/100.0 4
/4 R1A_SARS2 Non-structural protein 3

8uuf[1] C ACT
ACETATE ION[4 atoms] A 100.0
/100.0 1
/1 R1A_SARS2 Papain-like protease nsp3

8uug[4] D ACT
ACETATE ION[4 atoms] A 100.0
/100.0 3
/3 R1AB_SARS2 Papain-like protease nsp3

7lbs[2] F BO3
BORIC ACID[4 atoms] A 100.0
/100.0 4
/4 R1A_SARS2 Non-structural protein 3

7lbs[2] G BO3
BORIC ACID[4 atoms] A 100.0
/100.0 7
/7 R1A_SARS2 Non-structural protein 3

7lbs[1] I BO3
BORIC ACID[4 atoms] A 100.0
/100.0 10
/10 R1A_SARS2 Non-structural protein 3

7lbs[1] O BO3
BORIC ACID[4 atoms] B 100.0
/100.0 2
/2 R1A_SARS2 Non-structural protein 3

8uuh[1] C PEG
DI(HYDROXYETHYL)ETHER[7 atoms] A 100.0
/100.0 3
/3 R1A_SARS2 Papain-like protease nsp3

8uuh[2] D PEG
DI(HYDROXYETHYL)ETHER[7 atoms] A 100.0
/100.0 3
/3 R1A_SARS2 Papain-like protease nsp3

8uuy[1] D PGE
TRIETHYLENE GLYCOL[10 atoms] A 100.0
/100.0 1
/1 R1A_SARS2 Papain-like protease nsp3

3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.

MONOMER
1945
	pdb_id	a¹	identity[%]²	description
	7llf	A	100.0	R1A_SARS2 Non-structural protein 3
	8f2e	A	100.0	R1AB_SARS2 Papain-like protease nsp3
	6z72	A	100.0	R1AB_SARS2 Replicase polyprotein 1ab
	1.a¹:asym_id for the homologue. 2.identity[%]²:sequence identity between the query and the homologue.

Contact Molecules for Homologous Proteins

Summary Bars[100 %]

UniProt Feature Tables [YP_009725299.1()]