Contact Molecules for Homologous Proteins | ||||
[Full Bars] |
[SiteTable] |
|
[Back to Search Page] |
[Back to HOMCOS] |
[SupCon3D] |
[help] |
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100] | [show] [download] [help] |
PID | QueryLength | Homolgous Sequence in PDB | UniProt Query | TITLE |
4021742 | 631 | 7 | P17405(ASM_HUMAN) | RecName: Full=Sphingomyelin phosphodiesterase ; EC=3.1.4.12 ; EC=3.1.4.3 ;AltName: Full=Acid sphingomyelinase ; Short=aSMase;Contains: RecName: Full=Sphingomyelin phosphodiesterase, processed form ;Flags: Precursor; |
QUERYSEQ |
MPRYGASLRQSCPRSGREQGQDGTAGAPGLLWMGLVLALALALALALALSDSRVLWAPAEAHPLSPQGHPARLHRIVPRLRDVFGWGNLTCPICKGLFTAINLGLKKEPNVARVGSVAIKLCNLLKIAPPAVCQSIVHLFEDDMVEVWRR SVLSPSEACGLLLGSTCGHWDIFSSWNISLPTVPKPPPKPPSPPAPGAPVSRILFLTDLHWDHDYLEGTDPDCADPLCCRRGSGLPPASRPGAGYWGEYSKCDLPLRTLESLLSGLGPAGPFDMVYWTGDIPAHDVWHQTRQDQLRALTT VTALVRKFLGPVPVYPAVGNHESTPVNSFPPPFIEGNHSSRWLYEAMAKAWEPWLPAEALRTLRIGGFYALSPYPGLRLISLNMNFCSRENFWLLINSTDPAGQLQWLVGELQAAEDRGDKVHIIGHIPPGHCLKSWSWNYYRIVARYEN TLAAQFFGHTHVDEFEVFYDEETLSRPLAVAFLAPSATTYIGLNPGYRVYQIDGNYSGSSHVVLDHETYILNLTQANIPGAIPHWQLLYRARETYGLPNTLPTAWHNLVYRMRGDMQLFQTFWFLYHKGHPPSEPCGTPCRLATLCAQLS ARADSPALCRHLMPDGSLPEAQSLWPRPLFC |
631 | region | name | description |
1-46 | SIGNAL | ||
47-631 | CHAIN | /note="Sphingomyelin phosphodiesterase" /id="PRO_0000002323" | |
254-631 | CHAIN | /note="Sphingomyelin phosphodiesterase, processed form" /id="PRO_0000456684" | |
87-171 | DOMAIN | /note="Saposin B-type" | |
1-23 | REGION | /note="Disordered" | |
208-208 | BINDING | /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_label="1" ECO:0007744|PDB:5I81, ECO:0007744|PDB:5I85, ECO:0007744|PDB:5I8R, ECO:0007744|PDB:5JG8" | |
210-210 | BINDING | /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_label="1" ECO:0007744|PDB:5I81, ECO:0007744|PDB:5I85, ECO:0007744|PDB:5I8R, ECO:0007744|PDB:5JG8" | |
280-280 | BINDING | /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_label="1" ECO:0007744|PDB:5I81, ECO:0007744|PDB:5I85, ECO:0007744|PDB:5I8R, ECO:0007744|PDB:5JG8" | |
280-280 | BINDING | /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_label="2" ECO:0007744|PDB:5I81, ECO:0007744|PDB:5I85, ECO:0007744|PDB:5I8R, ECO:0007744|PDB:5JG8" | |
320-320 | BINDING | /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_label="2" ECO:0007744|PDB:5I81, ECO:0007744|PDB:5I85, ECO:0007744|PDB:5I8R, ECO:0007744|PDB:5JG8" | |
427-427 | BINDING | /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_label="2" ECO:0007744|PDB:5I81, ECO:0007744|PDB:5I85, ECO:0007744|PDB:5I8R, ECO:0007744|PDB:5JG8" | |
459-459 | BINDING | /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_label="2" ECO:0007744|PDB:5I81, ECO:0007744|PDB:5I85, ECO:0007744|PDB:5I8R, ECO:0007744|PDB:5JG8" | |
461-461 | BINDING | /ligand="Zn(2+)" /ligand_id="ChEBI:CHEBI:29105" /ligand_label="1" ECO:0007744|PDB:5I81, ECO:0007744|PDB:5I85, ECO:0007744|PDB:5I8R, ECO:0007744|PDB:5JG8" | |
1-196 | DISORDER | predicted by DISOPRED |
MONOMER | |||||||
631 | |||||||
pdb_id | a1 | identity[%]2 | description | ||||
5jg8 | B | 100.0 | ASM_HUMAN Sphingomyelin phosphodiesterase | ||||
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue. |
COMPOUND | |||||||
631 | pdb_id | contact mol | homologue | ||||
a3 | description | a4 | identity[%]5 | Ncon6 | description | ||
5i81[11] | E |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
A | 100.0 /100.0 |
1 /1 |
ASM_HUMAN Sphingomyelin phosphodiesterase | |
5i81[2] | E |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
A | 100.0 /100.0 |
2 /2 |
ASM_HUMAN Sphingomyelin phosphodiesterase | |
5i81[9] | F |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
A | 100.0 /100.0 |
3 /3 |
ASM_HUMAN Sphingomyelin phosphodiesterase | |
5i81[9] | H |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
A | 100.0 /100.0 |
2 /2 |
ASM_HUMAN Sphingomyelin phosphodiesterase | |
5i81[3] | J |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
A | 100.0 /100.0 |
6 /6 |
ASM_HUMAN Sphingomyelin phosphodiesterase | |
5i8r[1] | BA |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
C | 100.0 /100.0 |
1 /1 |
ASM_HUMAN Sphingomyelin phosphodiesterase | |
5jg8[2] | N |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
A | 100.0 /100.0 |
5 /5 |
ASM_HUMAN Sphingomyelin phosphodiesterase | |
5jg8[1] | O |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
A | 100.0 /100.0 |
2 /2 |
ASM_HUMAN Sphingomyelin phosphodiesterase | |
5jg8[2] | S |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
A | 100.0 /100.0 |
1 /1 |
ASM_HUMAN Sphingomyelin phosphodiesterase | |
5i85[4] | U |
PC
PHOSPHOCHOLINE[11 atoms] |
A | 100.0 /100.0 |
9 /9 |
ASM_HUMAN Sphingomyelin phosphodiesterase | |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
METAL | |||||||
631 | pdb_id | contact mol | homologue | ||||
a3 | description | a4 | identity[%]5 | Ncon6 | description | ||
5i81[18] | L |
ZN
ZINC ION[1 atoms] |
A | 100.0 /100.0 |
5 /5 |
ASM_HUMAN Sphingomyelin phosphodiesterase | |
5jg8[4] | J |
ZN
ZINC ION[1 atoms] |
A | 100.0 /100.0 |
4 /4 |
ASM_HUMAN Sphingomyelin phosphodiesterase | |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
OTHERPOLY | |||||||
631 | pdb_id | contact mol | homologue | ||||
a3 | description | a4 | identity[%]5 | Ncon6 | description | ||
5i81[4] | B | 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. | A | 100.0 /100.0 |
5 /5 |
ASM_HUMAN Sphingomyelin phosphodiesterase | |
5i85[5] | D | 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. | A | 100.0 /100.0 |
7 /7 |
ASM_HUMAN Sphingomyelin phosphodiesterase | |
5i8r[2] | E | 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. | A | 100.0 /100.0 |
2 /2 |
ASM_HUMAN Sphingomyelin phosphodiesterase | |
5jg8[1] | C | 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. | A | 100.0 /100.0 |
5 /5 |
ASM_HUMAN Sphingomyelin phosphodiesterase | |
5jg8[2] | D | 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. | A | 100.0 /100.0 |
3 /3 |
ASM_HUMAN Sphingomyelin phosphodiesterase | |
5jg8[1] | H | 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. | B | 100.0 /100.0 |
2 /2 |
ASM_HUMAN Sphingomyelin phosphodiesterase | |
5i81[2] | C | beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. | A | 100.0 /100.0 |
3 /3 |
ASM_HUMAN Sphingomyelin phosphodiesterase | |
5i85[4] | B | beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. | A | 100.0 /100.0 |
3 /3 |
ASM_HUMAN Sphingomyelin phosphodiesterase | |
5i8r[1] | H | beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-bet.. | B | 100.0 /100.0 |
4 /4 |
ASM_HUMAN Sphingomyelin phosphodiesterase | |
5i81[2] | D | beta-D-mannopyranose-(1-3)-alpha-D-mannopyranose | A | 100.0 /100.0 |
3 /3 |
ASM_HUMAN Sphingomyelin phosphodiesterase | |
5i85[4] | C | alpha-D-mannopyranose-(1-3)-alpha-D-mannopyranose-.. | A | 100.0 /100.0 |
7 /7 |
ASM_HUMAN Sphingomyelin phosphodiesterase | |
5jg8[1] | E | 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-3)-2-a.. | A | 100.0 /100.0 |
4 /4 |
ASM_HUMAN Sphingomyelin phosphodiesterase | |
5jg8[1] | F | alpha-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-be.. | B | 100.0 /100.0 |
6 /6 |
ASM_HUMAN Sphingomyelin phosphodiesterase | |
5jg8[1] | G | alpha-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-be.. | B | 100.0 /100.0 |
5 /5 |
ASM_HUMAN Sphingomyelin phosphodiesterase | |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
HOMO | |||||||
631 | pdb_id | contact mol | homologue | ||||
a3 | description | a4 | identity[%]5 | Ncon6 | description | ||
5i81[4] | A | ASM_HUMAN Sphingomyelin phosphodiesterase[528 aa] | A | 100.0 /100.0 |
28 /28 |
ASM_HUMAN Sphingomyelin phosphodiesterase | |
5i85[4] | A | ASM_HUMAN Sphingomyelin phosphodiesterase[528 aa] | A | 100.0 /100.0 |
9 /9 |
ASM_HUMAN Sphingomyelin phosphodiesterase | |
5i85[4] | A | ASM_HUMAN Sphingomyelin phosphodiesterase[528 aa] | A | 100.0 /100.0 |
11 /11 |
ASM_HUMAN Sphingomyelin phosphodiesterase | |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
PRECIPITANT | |||||||
631 | pdb_id | contact mol | homologue | ||||
a3 | description | a4 | identity[%]5 | Ncon6 | description | ||
5i81[6] | N |
SO4
SULFATE ION[5 atoms] |
A | 100.0 /100.0 |
2 /2 |
ASM_HUMAN Sphingomyelin phosphodiesterase | |
5i81[8] | O |
SO4
SULFATE ION[5 atoms] |
A | 100.0 /100.0 |
2 /2 |
ASM_HUMAN Sphingomyelin phosphodiesterase | |
5i81[6] | P |
SO4
SULFATE ION[5 atoms] |
A | 100.0 /100.0 |
3 /3 |
ASM_HUMAN Sphingomyelin phosphodiesterase | |
5i81[6] | Q |
SO4
SULFATE ION[5 atoms] |
A | 100.0 /100.0 |
2 /2 |
ASM_HUMAN Sphingomyelin phosphodiesterase | |
5i81[6] | R |
SO4
SULFATE ION[5 atoms] |
A | 100.0 /100.0 |
5 /5 |
ASM_HUMAN Sphingomyelin phosphodiesterase | |
5i81[2] | S |
SO4
SULFATE ION[5 atoms] |
A | 100.0 /100.0 |
2 /2 |
ASM_HUMAN Sphingomyelin phosphodiesterase | |
5i81[6] | T |
SO4
SULFATE ION[5 atoms] |
A | 100.0 /100.0 |
6 /6 |
ASM_HUMAN Sphingomyelin phosphodiesterase | |
5i81[6] | U |
SO4
SULFATE ION[5 atoms] |
A | 100.0 /100.0 |
3 /3 |
ASM_HUMAN Sphingomyelin phosphodiesterase | |
5i81[2] | V |
SO4
SULFATE ION[5 atoms] |
A | 100.0 /100.0 |
3 /3 |
ASM_HUMAN Sphingomyelin phosphodiesterase | |
5i81[12] | W |
SO4
SULFATE ION[5 atoms] |
A | 100.0 /100.0 |
4 /4 |
ASM_HUMAN Sphingomyelin phosphodiesterase | |
5i85[4] | P |
SO4
SULFATE ION[5 atoms] |
A | 100.0 /100.0 |
2 /2 |
ASM_HUMAN Sphingomyelin phosphodiesterase | |
5i85[4] | S |
SO4
SULFATE ION[5 atoms] |
A | 100.0 /100.0 |
1 /1 |
ASM_HUMAN Sphingomyelin phosphodiesterase | |
5i85[4] | T |
SO4
SULFATE ION[5 atoms] |
A | 100.0 /100.0 |
3 /3 |
ASM_HUMAN Sphingomyelin phosphodiesterase | |
5jg8[2] | L |
ACT
ACETATE ION[4 atoms] |
A | 100.0 /100.0 |
7 /7 |
ASM_HUMAN Sphingomyelin phosphodiesterase | |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. |