HOMCOS(prot_sch_conbars.cgi):

		Contact Molecules for Homologous Proteins
[Full Bars]	[SiteTable]	Summary Bars[80 %]	[Back to Search Page]	[Back to HOMCOS]
[SupCon3D]	[help]	seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100]	[show] [download] [help]

PID	QueryLength	Homolgous Sequence in PDB	UniProt Query	TITLE
2676554	163	19	Q96PD4(IL17F_HUMAN)	RecName: Full=Interleukin-17F; Short=IL-17F;AltName: Full=Cytokine ML-1;Flags: Precursor;
QUERYSEQ	MTVKTLHGPAMVKYLLLSILGLAFLSEAAARKIPKVGHTFFQKPESCPPVPGGSMKLDIGIINENQRVSMSRNIESRSTSPWNYTVTWDPNRYPSEVVQAQCRNLGCINAQGKEDISMNSVPIQQETLVVRRKHQGCSVSFQLEKVLVTV GCTCVTPVIHHVQ

[BLAST file for PDB] (plain) (bar) (multiple alignment) [BLAST for UniProt: (plain) (bar) (multiple alignment) (PSSM file) ]

UniProt Feature Tables [Q96PD4(IL17F_HUMAN)]

163
	region	name	description
	1-30	SIGNAL
	31-163	CHAIN	/note="Interleukin-17F" /id="PRO_0000015432"
	1-163	DISORDER	predicted by DISOPRED

MONOMER

163

pdb_id a¹ identity[%]² description

6hgo C 100.0 IL17F_HUMAN Interleukin-17F

1.a¹:asym_id for the homologue. 2.identity[%]²:sequence identity between the query and the homologue.

HETERO

163 pdb_id contact mol homologue

a³ description a⁴ identity[%]⁵ Ncon⁶ description

3jvf[1] C I17RA_HUMAN Interleukin-17 receptor A[271 aa] A 100.0
/100.0 16
/16 IL17F_HUMAN Interleukin-17F

3jvf[3] C I17RA_HUMAN Interleukin-17 receptor A[271 aa] B 100.0
/100.0 25
/25 IL17F_HUMAN Interleukin-17F

5n92[3] A IL17_HUMAN Interleukin-17A[109 aa] B 100.0
/100.0 58
/58 IL17F_HUMAN Interleukin-17F

6hg4[4] B I17RC_HUMAN Interleukin-17 receptor C[427 aa] A 100.0
/100.0 21
/21 IL17F_HUMAN Interleukin-17F

6hg4[4] B I17RC_HUMAN Interleukin-17 receptor C[427 aa] A 100.0
/100.0 16
/16 IL17F_HUMAN Interleukin-17F

6ppg[2] B Fab MCAF5352A light chain[212 aa] A 100.0
/100.0 1
/1 IL17F_HUMAN Interleukin-17F

6ppg[2] E Fab MCAF5352A light chain[216 aa] A 100.0
/100.0 7
/7 IL17F_HUMAN Interleukin-17F

6ppg[2] C Fab MCAF5352A heavy chain[223 aa] A 100.0
/100.0 3
/3 IL17F_HUMAN Interleukin-17F

6ppg[2] D Fab MCAF5352A heavy chain[226 aa] A 100.0
/100.0 7
/7 IL17F_HUMAN Interleukin-17F

8ruu[2] A Immunoblobulin heavy chain[219 aa] C 100.0
/100.0 11
/11 IL17F_HUMAN Interleukin-17F

8ruu[2] B Immunoblobulin light chain[213 aa] C 100.0
/100.0 11
/11 IL17F_HUMAN Interleukin-17F

8ruu[2] E Immunoblobulin light chain[213 aa] C 100.0
/100.0 6
/6 IL17F_HUMAN Interleukin-17F

3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.

COMPOUND

163 pdb_id contact mol homologue

a³ description a⁴ identity[%]⁵ Ncon⁶ description

1jpy[2] G NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. A 100.0
/100.0 2
/2 interleukin 17F

5nan[4] L NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. E 100.0
/100.0 1
/1 IL17F_HUMAN Interleukin-17F

6ppg[3] G NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. A 100.0
/100.0 2
/2 IL17F_HUMAN Interleukin-17F

3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.

METAL

163 pdb_id contact mol homologue

a³ description a⁴ identity[%]⁵ Ncon⁶ description

3jvf[1] E CA
CALCIUM ION[1 atoms] B 100.0
/100.0 2
/2 IL17F_HUMAN Interleukin-17F

6ppg[2] H CD
CADMIUM ION[1 atoms] A 100.0
/100.0 2
/2 IL17F_HUMAN Interleukin-17F

6ppg[2] I CD
CADMIUM ION[1 atoms] A 100.0
/100.0 1
/1 IL17F_HUMAN Interleukin-17F

6ppg[1] J CD
CADMIUM ION[1 atoms] A 100.0
/100.0 1
/1 IL17F_HUMAN Interleukin-17F

6ppg[1] K CD
CADMIUM ION[1 atoms] A 100.0
/100.0 1
/1 IL17F_HUMAN Interleukin-17F

6ppg[1] L CD
CADMIUM ION[1 atoms] A 100.0
/100.0 1
/1 IL17F_HUMAN Interleukin-17F

6ppg[1] DB CD
CADMIUM ION[1 atoms] F 100.0
/100.0 1
/1 IL17F_HUMAN Interleukin-17F

6ppg[1] HB CD
CADMIUM ION[1 atoms] F 100.0
/100.0 1
/1 IL17F_HUMAN Interleukin-17F

6ppg[1] IB CD
CADMIUM ION[1 atoms] F 100.0
/100.0 1
/1 IL17F_HUMAN Interleukin-17F

3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.

OTHERPOLY

163 pdb_id contact mol homologue

a³ description a⁴ identity[%]⁵ Ncon⁶ description

1jpy[1] E 2-acetamido-2-deoxy-alpha-D-glucopyranose-(1-4)-2-.. B 100.0
/100.0 2
/2 interleukin 17F

1jpy[1] F 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. C 100.0
/100.0 3
/3 interleukin 17F

3jvf[1] D 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. A 100.0
/100.0 3
/3 IL17F_HUMAN Interleukin-17F

6hgo[1] E 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. B 100.0
/100.0 3
/3 IL17F_HUMAN Interleukin-17F

5n92[1] C 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-[al.. B 100.0
/100.0 3
/3 IL17F_HUMAN Interleukin-17F

5nan[1] G 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-[be.. F 100.0
/100.0 2
/2 IL17F_HUMAN Interleukin-17F

8ruu[1] G alpha-D-mannopyranose-(1-3)-beta-D-mannopyranose-(.. C 100.0
/100.0 4
/4 IL17F_HUMAN Interleukin-17F

3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.

HOMO

163 pdb_id contact mol homologue

a³ description a⁴ identity[%]⁵ Ncon⁶ description

1jpy[18] B interleukin 17F[121 aa] A 100.0
/100.0 64
/64 interleukin 17F

3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.

PRECIPITANT

163 pdb_id contact mol homologue

a³ description a⁴ identity[%]⁵ Ncon⁶ description

1jpy[1] H SO4
SULFATE ION[5 atoms] C 100.0
/100.0 2
/2 interleukin 17F

6hgo[1] I SO4
SULFATE ION[5 atoms] D 100.0
/100.0 3
/3 IL17F_HUMAN Interleukin-17F

3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.

MONOMER
163
	pdb_id	a¹	identity[%]²	description
	6hgo	C	100.0	IL17F_HUMAN Interleukin-17F
	1.a¹:asym_id for the homologue. 2.identity[%]²:sequence identity between the query and the homologue.

HETERO
163	pdb_id	contact mol		homologue
	pdb_id	a³	description	a⁴	identity[%]⁵	Ncon⁶	description
	3jvf[1]	C	I17RA_HUMAN Interleukin-17 receptor A[271 aa]	A	100.0 /100.0	16 /16	IL17F_HUMAN Interleukin-17F
	3jvf[3]	C	I17RA_HUMAN Interleukin-17 receptor A[271 aa]	B	100.0 /100.0	25 /25	IL17F_HUMAN Interleukin-17F
	5n92[3]	A	IL17_HUMAN Interleukin-17A[109 aa]	B	100.0 /100.0	58 /58	IL17F_HUMAN Interleukin-17F
	6hg4[4]	B	I17RC_HUMAN Interleukin-17 receptor C[427 aa]	A	100.0 /100.0	21 /21	IL17F_HUMAN Interleukin-17F
	6hg4[4]	B	I17RC_HUMAN Interleukin-17 receptor C[427 aa]	A	100.0 /100.0	16 /16	IL17F_HUMAN Interleukin-17F
	6ppg[2]	B	Fab MCAF5352A light chain[212 aa]	A	100.0 /100.0	1 /1	IL17F_HUMAN Interleukin-17F
	6ppg[2]	E	Fab MCAF5352A light chain[216 aa]	A	100.0 /100.0	7 /7	IL17F_HUMAN Interleukin-17F
	6ppg[2]	C	Fab MCAF5352A heavy chain[223 aa]	A	100.0 /100.0	3 /3	IL17F_HUMAN Interleukin-17F
	6ppg[2]	D	Fab MCAF5352A heavy chain[226 aa]	A	100.0 /100.0	7 /7	IL17F_HUMAN Interleukin-17F
	8ruu[2]	A	Immunoblobulin heavy chain[219 aa]	C	100.0 /100.0	11 /11	IL17F_HUMAN Interleukin-17F
	8ruu[2]	B	Immunoblobulin light chain[213 aa]	C	100.0 /100.0	11 /11	IL17F_HUMAN Interleukin-17F
	8ruu[2]	E	Immunoblobulin light chain[213 aa]	C	100.0 /100.0	6 /6	IL17F_HUMAN Interleukin-17F
	3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
COMPOUND
163	pdb_id	contact mol		homologue
	pdb_id	a³	description	a⁴	identity[%]⁵	Ncon⁶	description
	1jpy[2]	G	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..	A	100.0 /100.0	2 /2	interleukin 17F
	5nan[4]	L	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..	E	100.0 /100.0	1 /1	IL17F_HUMAN Interleukin-17F
	6ppg[3]	G	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms]..	A	100.0 /100.0	2 /2	IL17F_HUMAN Interleukin-17F
	3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
METAL
163	pdb_id	contact mol		homologue
	pdb_id	a³	description	a⁴	identity[%]⁵	Ncon⁶	description
	3jvf[1]	E	CA CALCIUM ION[1 atoms]	B	100.0 /100.0	2 /2	IL17F_HUMAN Interleukin-17F
	6ppg[2]	H	CD CADMIUM ION[1 atoms]	A	100.0 /100.0	2 /2	IL17F_HUMAN Interleukin-17F
	6ppg[2]	I	CD CADMIUM ION[1 atoms]	A	100.0 /100.0	1 /1	IL17F_HUMAN Interleukin-17F
	6ppg[1]	J	CD CADMIUM ION[1 atoms]	A	100.0 /100.0	1 /1	IL17F_HUMAN Interleukin-17F
	6ppg[1]	K	CD CADMIUM ION[1 atoms]	A	100.0 /100.0	1 /1	IL17F_HUMAN Interleukin-17F
	6ppg[1]	L	CD CADMIUM ION[1 atoms]	A	100.0 /100.0	1 /1	IL17F_HUMAN Interleukin-17F
	6ppg[1]	DB	CD CADMIUM ION[1 atoms]	F	100.0 /100.0	1 /1	IL17F_HUMAN Interleukin-17F
	6ppg[1]	HB	CD CADMIUM ION[1 atoms]	F	100.0 /100.0	1 /1	IL17F_HUMAN Interleukin-17F
	6ppg[1]	IB	CD CADMIUM ION[1 atoms]	F	100.0 /100.0	1 /1	IL17F_HUMAN Interleukin-17F
	3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
OTHERPOLY
163	pdb_id	contact mol		homologue
	pdb_id	a³	description	a⁴	identity[%]⁵	Ncon⁶	description
	1jpy[1]	E	2-acetamido-2-deoxy-alpha-D-glucopyranose-(1-4)-2-..	B	100.0 /100.0	2 /2	interleukin 17F
	1jpy[1]	F	2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a..	C	100.0 /100.0	3 /3	interleukin 17F
	3jvf[1]	D	2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a..	A	100.0 /100.0	3 /3	IL17F_HUMAN Interleukin-17F
	6hgo[1]	E	2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a..	B	100.0 /100.0	3 /3	IL17F_HUMAN Interleukin-17F
	5n92[1]	C	2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-[al..	B	100.0 /100.0	3 /3	IL17F_HUMAN Interleukin-17F
	5nan[1]	G	2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-[be..	F	100.0 /100.0	2 /2	IL17F_HUMAN Interleukin-17F
	8ruu[1]	G	alpha-D-mannopyranose-(1-3)-beta-D-mannopyranose-(..	C	100.0 /100.0	4 /4	IL17F_HUMAN Interleukin-17F
	3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
HOMO
163	pdb_id	contact mol		homologue
	pdb_id	a³	description	a⁴	identity[%]⁵	Ncon⁶	description
	1jpy[18]	B	interleukin 17F[121 aa]	A	100.0 /100.0	64 /64	interleukin 17F
	3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.
PRECIPITANT
163	pdb_id	contact mol		homologue
	pdb_id	a³	description	a⁴	identity[%]⁵	Ncon⁶	description
	1jpy[1]	H	SO4 SULFATE ION[5 atoms]	C	100.0 /100.0	2 /2	interleukin 17F
	6hgo[1]	I	SO4 SULFATE ION[5 atoms]	D	100.0 /100.0	3 /3	IL17F_HUMAN Interleukin-17F
	3.a³:asym_id for the contact molecule. 4.a⁴:asym_id for the template homologue. 5.identity[%]⁵:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon⁶:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue.

Contact Molecules for Homologous Proteins

Summary Bars[80 %]

UniProt Feature Tables [Q96PD4(IL17F_HUMAN)]