Contact Molecules for Homologous Proteins | ||||
[Full Bars] |
[SiteTable] |
|
[Back to Search Page] |
[Back to HOMCOS] |
[SupCon3D] |
[help] |
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100] | [show] [download] [help] |
PID | QueryLength | Homolgous Sequence in PDB | UniProt Query | TITLE |
2676554 | 163 | 73 | Q96PD4(IL17F_HUMAN) | RecName: Full=Interleukin-17F; Short=IL-17F;AltName: Full=Cytokine ML-1;Flags: Precursor; |
QUERYSEQ |
MTVKTLHGPAMVKYLLLSILGLAFLSEAAARKIPKVGHTFFQKPESCPPVPGGSMKLDIGIINENQRVSMSRNIESRSTSPWNYTVTWDPNRYPSEVVQAQCRNLGCINAQGKEDISMNSVPIQQETLVVRRKHQGCSVSFQLEKVLVTV GCTCVTPVIHHVQ |
163 | region | name | description |
1-30 | SIGNAL | ||
31-163 | CHAIN | /note="Interleukin-17F" /id="PRO_0000015432" | |
1-163 | DISORDER | predicted by DISOPRED |
MONOMER | |||||||
163 | |||||||
pdb_id | a1 | identity[%]2 | description | ||||
6hgo | C | 100.0 | IL17F_HUMAN Interleukin-17F | ||||
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue. |
HETERO | |||||||
163 | pdb_id | contact mol | homologue | ||||
a3 | description | a4 | identity[%]5 | Ncon6 | description | ||
5n92[3] | A | IL17_HUMAN Interleukin-17A[109 aa] | B | 100.0 /100.0 |
58 /58 |
IL17F_HUMAN Interleukin-17F | |
6ppg[2] | C | Fab MCAF5352A heavy chain[223 aa] | A | 100.0 /100.0 |
3 /3 |
IL17F_HUMAN Interleukin-17F | |
6ppg[2] | D | Fab MCAF5352A heavy chain[226 aa] | A | 100.0 /100.0 |
7 /7 |
IL17F_HUMAN Interleukin-17F | |
8ruu[2] | A | Immunoblobulin heavy chain[219 aa] | C | 100.0 /100.0 |
11 /11 |
IL17F_HUMAN Interleukin-17F | |
8ruu[2] | B | Immunoblobulin light chain[213 aa] | C | 100.0 /100.0 |
11 /11 |
IL17F_HUMAN Interleukin-17F | |
8ruu[2] | E | Immunoblobulin light chain[213 aa] | C | 100.0 /100.0 |
6 /6 |
IL17F_HUMAN Interleukin-17F | |
8dy1[2] | C | scFv CAT2200 LH[228 aa] | A | 57.1 /61.1 |
7 /7 |
IL17_HUMAN Interleukin-17A | |
5n7w[2] | B | Antibody Fragment Light Chain[210 aa] | E | 100.0 /64.6 |
1 /4 |
IL17_HUMAN Interleukin-17A | |
5n7w[2] | D | Antibody Fragment Light Chain[211 aa] | E | 55.6 /64.6 |
9 /15 |
IL17_HUMAN Interleukin-17A | |
5n7w[2] | C | Antibody Fragment Heavy Chain[216 aa] | E | 0.0 /64.6 |
1 /4 |
IL17_HUMAN Interleukin-17A | |
5nan[1] | F | IL17F_HUMAN Interleukin-17F[113 aa] | A | 72.7 /64.4 |
33 /42 |
IL17_HUMAN Interleukin-17A | |
7uwn[1] | F | I17RA_HUMAN Interleukin-17 receptor A[237 aa] | D | 75.0 /64.4 |
16 /19 |
IL17_HUMAN Interleukin-17A | |
2vxs[6] | E | FAB FRAGMENT[216 aa] | A | 40.0 /64.2 |
5 /6 |
IL17_HUMAN INTERLEUKIN-17A | |
2vxs[6] | F | FAB FRAGMENT[221 aa] | A | 66.7 /64.2 |
6 /6 |
IL17_HUMAN INTERLEUKIN-17A | |
5hhv[2] | C | CAT-2000 FAB heavy chain[220 aa] | A | 70.0 /60.0 |
10 /10 |
IL17_HUMAN Interleukin-17A | |
5hhv[2] | C | CAT-2000 FAB heavy chain[220 aa] | A | 40.0 /60.0 |
5 /5 |
IL17_HUMAN Interleukin-17A | |
5hi3[6] | C | CAT-2000 FAB heavy chain[220 aa] | A | 75.0 /64.4 |
8 /8 |
IL17_HUMAN Interleukin-17A | |
5hi3[6] | E | CAT-2000 FAB heavy chain[220 aa] | A | 40.0 /64.4 |
5 /7 |
IL17_HUMAN Interleukin-17A | |
2vxs[6] | J | FAB FRAGMENT[215 aa] | A | 40.0 /64.2 |
5 /5 |
IL17_HUMAN INTERLEUKIN-17A | |
5hhv[2] | E | CAT-2000 FAB light chain[213 aa] | A | 40.0 /60.0 |
5 /5 |
IL17_HUMAN Interleukin-17A | |
5hi3[6] | D | CAT-2000 FAB light chain[213 aa] | A | 40.0 /64.4 |
5 /5 |
IL17_HUMAN Interleukin-17A | |
5hhv[2] | D | IL-17A peptide inhibitor[14 aa] | A | 66.7 /60.0 |
6 /6 |
IL17_HUMAN Interleukin-17A | |
5hhv[2] | D | IL-17A peptide inhibitor[14 aa] | A | 75.0 /60.0 |
8 /8 |
IL17_HUMAN Interleukin-17A | |
5hhx[2] | D | IL-17A peptide inhibitor[14 aa] | A | 66.7 /61.6 |
6 /6 |
IL17_HUMAN Interleukin-17A | |
5hhx[2] | D | IL-17A peptide inhibitor[14 aa] | A | 77.8 /61.6 |
9 /9 |
IL17_HUMAN Interleukin-17A | |
5hi3[3] | F | synthetic IL-17A peptide inhibitor[14 aa] | A | 71.4 /64.4 |
7 /15 |
IL17_HUMAN Interleukin-17A | |
5hi3[3] | F | synthetic IL-17A peptide inhibitor[14 aa] | B | 60.0 /64.3 |
5 /5 |
IL17_HUMAN Interleukin-17A | |
6wio[4] | A | Fab Heavy chain[230 aa] | C | 60.0 /61.4 |
10 /10 |
IL17_HUMAN Interleukin-17A | |
6wio[4] | A | Fab Heavy chain[230 aa] | C | 33.3 /61.4 |
3 /4 |
IL17_HUMAN Interleukin-17A | |
5vb9[4] | C | Peptide inhibitor[15 aa] | A | 33.3 /63.2 |
9 /10 |
IL17_HUMAN Interleukin-17A | |
5vb9[4] | C | Peptide inhibitor[15 aa] | A | 80.0 /63.2 |
5 /9 |
IL17_HUMAN Interleukin-17A | |
4qhu[1] | A | Fab6785 light chain[209 aa] | F | 100.0 /62.5 |
1 /1 |
IL17_HUMAN Interleukin-17A | |
4qhu[1] | C | Fab6785 light chain[209 aa] | F | 54.5 /62.5 |
11 /13 |
IL17_HUMAN Interleukin-17A | |
4qhu[1] | D | Fab6785 heavy chain[210 aa] | F | 28.6 /62.5 |
7 /7 |
IL17_HUMAN Interleukin-17A | |
3jvf[5] | C | I17RA_HUMAN Interleukin-17 receptor A[271 aa] | A | 100.0 /100.0 |
16 /16 |
IL17F_HUMAN Interleukin-17F | |
3jvf[3] | C | I17RA_HUMAN Interleukin-17 receptor A[271 aa] | B | 100.0 /100.0 |
25 /25 |
IL17F_HUMAN Interleukin-17F | |
4hsa[2] | C | I17RA_HUMAN Interleukin-17 receptor A[272 aa] | A | 78.9 /63.2 |
19 /20 |
IL17_HUMAN Interleukin-17A | |
6hg4[4] | B | I17RC_HUMAN Interleukin-17 receptor C[427 aa] | A | 100.0 /100.0 |
21 /21 |
IL17F_HUMAN Interleukin-17F | |
6hg4[4] | B | I17RC_HUMAN Interleukin-17 receptor C[427 aa] | A | 100.0 /100.0 |
16 /16 |
IL17F_HUMAN Interleukin-17F | |
7uwn[1] | G | I17RC_HUMAN Isoform 5 of Interleukin-17 receptor C[403 aa] | A | 46.7 /62.2 |
15 /19 |
IL17_HUMAN Interleukin-17A | |
8dy5[2] | A | spFv CAT2200 LH[244 aa] | C | 66.7 /60.7 |
9 /9 |
IL17_HUMAN Interleukin-17A | |
7wkx[2] | B | Heavy chain of HB0017 Fab[212 aa] | E | 75.0 /63.1 |
8 /10 |
IL17_HUMAN Interleukin-17A | |
7wkx[2] | D | Light chain of HB0017 Fab[216 aa] | E | 40.0 /63.1 |
5 /5 |
IL17_HUMAN Interleukin-17A | |
6ppg[2] | B | Fab MCAF5352A light chain[212 aa] | A | 100.0 /100.0 |
1 /1 |
IL17F_HUMAN Interleukin-17F | |
6ppg[2] | E | Fab MCAF5352A light chain[216 aa] | A | 100.0 /100.0 |
7 /7 |
IL17F_HUMAN Interleukin-17F | |
6wio[4] | B | Fab Light chain[213 aa] | C | 0.0 /61.4 |
2 /4 |
IL17_HUMAN Interleukin-17A | |
6wio[4] | B | Fab Light chain[213 aa] | C | 50.0 /61.4 |
4 /4 |
IL17_HUMAN Interleukin-17A | |
7z2m[1] | A | 11.003 Fab light-chain[213 aa] | K | 87.5 /60.9 |
8 /8 |
IL17_HUMAN Interleukin-17A | |
7z2m[1] | E | 11.003 Fab light-chain[214 aa] | K | 0.0 /60.9 |
1 /1 |
IL17_HUMAN Interleukin-17A | |
7z2m[1] | B | 11.003 Fab heavy-chain[219 aa] | K | 41.7 /60.9 |
12 /12 |
IL17_HUMAN Interleukin-17A | |
8b7w[2] | A | anti-IL-17A-76[125 aa] | B | 55.6 /60.4 |
18 /18 |
IL17_HUMAN Interleukin-17A | |
8b7w[2] | A | anti-IL-17A-76[125 aa] | B | 50.0 /60.4 |
2 /3 |
IL17_HUMAN Interleukin-17A | |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
COMPOUND | |||||||
163 | pdb_id | contact mol | homologue | ||||
a3 | description | a4 | identity[%]5 | Ncon6 | description | ||
1jpy[2] | G |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
A | 100.0 /100.0 |
2 /2 |
interleukin 17F | |
5nan[4] | L |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
E | 100.0 /100.0 |
1 /1 |
IL17F_HUMAN Interleukin-17F | |
6ppg[3] | G |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
A | 100.0 /100.0 |
2 /2 |
IL17F_HUMAN Interleukin-17F | |
7uwn[1] | I |
NAG
2-acetamido-2-deoxy-beta-D-glucopyranose[14 atoms].. |
A | 0.0 /62.2 |
2 /2 |
IL17_HUMAN Interleukin-17A | |
5hi3[2] | H |
63O
N-(4-{2-[({1-[2-(dimethylamino)-2-oxoethyl]cyclope.. |
A | 80.0 /64.4 |
5 /5 |
IL17_HUMAN Interleukin-17A | |
5hi5[2] | H |
63Q
(4S,20R)-7-chloro-N-methyl-4-{[(1-methyl-1H-pyrazo.. |
A | 75.0 /64.2 |
4 /4 |
IL17_HUMAN Interleukin-17A | |
7ama[1] | C |
RMK
~{N}-[(2~{S})-1,1-dicyclopropyl-3-[[4-(3,5-dimethy.. |
B | 60.0 /63.9 |
10 /10 |
IL17_HUMAN Interleukin-17A | |
8dyf[2] | C |
U5I
(5M)-3-[({2-[2-(2-{2-[2-({[(5M)-3-carboxy-5-(5,8-d.. |
A | 91.7 /62.4 |
12 /12 |
IL17_HUMAN Interleukin-17A | |
8cdg[2] | C |
UTF
(9~{S},12~{R},19~{S})-9-[[4-[[(2~{S})-2-cyclohexyl.. |
A | 44.4 /62.7 |
9 /9 |
IL17_HUMAN Interleukin-17A | |
8usr[4] | E |
XCE
~{N}-[(2~{S})-1-[[(1~{S})-1-(8~{a}~{H}-imidazo[1,2.. |
A | 44.4 /63.4 |
9 /9 |
IL17_HUMAN Interleukin-17A | |
8usr[4] | F |
XCE
~{N}-[(2~{S})-1-[[(1~{S})-1-(8~{a}~{H}-imidazo[1,2.. |
A | 80.0 /63.4 |
5 /5 |
IL17_HUMAN Interleukin-17A | |
8dyg[2] | C |
U5Q
(5P)-2-hydroxy-5-(6-methylquinolin-5-yl)benzoic ac.. |
A | 87.5 /64.7 |
8 /8 |
IL17_HUMAN Interleukin-17A | |
8dyg[2] | D |
U5Q
(5P)-2-hydroxy-5-(6-methylquinolin-5-yl)benzoic ac.. |
A | 100.0 /64.7 |
2 /2 |
IL17_HUMAN Interleukin-17A | |
8dyh[4] | C |
U5X
(5P)-N-benzyl-6-chloro-5-(quinolin-5-yl)pyridin-3-.. |
A | 100.0 /65.1 |
7 /7 |
IL17_HUMAN Interleukin-17A | |
5hi4[2] | H |
63P
(9'S,17'R)-6'-chloro-N-methyl-9'-{[(1-methyl-1H-py.. |
A | 54.5 /61.4 |
11 /11 |
IL17_HUMAN Interleukin-17A | |
7amg[3] | E |
RMQ
(3~{R})-4-[4-[[(2~{S})-2-[[2,2-bis(fluoranyl)-2-ph.. |
B | 66.7 /61.4 |
6 /6 |
IL17_HUMAN Interleukin-17A | |
7wkx[1] | P |
MLA
MALONIC ACID[7 atoms] |
E | 0.0 /63.1 |
2 /2 |
IL17_HUMAN Interleukin-17A | |
7wkx[1] | Q |
MLA
MALONIC ACID[7 atoms] |
F | 33.3 /61.4 |
3 /3 |
IL17_HUMAN Interleukin-17A | |
8dyi[4] | C |
U6C
(5P)-5-[5-(benzylamino)pyridin-3-yl]-N-[2-(morphol.. |
A | 83.3 /64.2 |
6 /6 |
IL17_HUMAN Interleukin-17A | |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
METAL | |||||||
163 | pdb_id | contact mol | homologue | ||||
a3 | description | a4 | identity[%]5 | Ncon6 | description | ||
3jvf[1] | E |
CA
CALCIUM ION[1 atoms] |
B | 100.0 /100.0 |
2 /2 |
IL17F_HUMAN Interleukin-17F | |
6ppg[2] | H |
CD
CADMIUM ION[1 atoms] |
A | 100.0 /100.0 |
2 /2 |
IL17F_HUMAN Interleukin-17F | |
6ppg[2] | I |
CD
CADMIUM ION[1 atoms] |
A | 100.0 /100.0 |
1 /1 |
IL17F_HUMAN Interleukin-17F | |
6ppg[1] | J |
CD
CADMIUM ION[1 atoms] |
A | 100.0 /100.0 |
1 /1 |
IL17F_HUMAN Interleukin-17F | |
6ppg[1] | K |
CD
CADMIUM ION[1 atoms] |
A | 100.0 /100.0 |
1 /1 |
IL17F_HUMAN Interleukin-17F | |
6ppg[1] | L |
CD
CADMIUM ION[1 atoms] |
A | 100.0 /100.0 |
1 /1 |
IL17F_HUMAN Interleukin-17F | |
6ppg[1] | DB |
CD
CADMIUM ION[1 atoms] |
F | 100.0 /100.0 |
1 /1 |
IL17F_HUMAN Interleukin-17F | |
6ppg[1] | HB |
CD
CADMIUM ION[1 atoms] |
F | 100.0 /100.0 |
1 /1 |
IL17F_HUMAN Interleukin-17F | |
6ppg[1] | IB |
CD
CADMIUM ION[1 atoms] |
F | 100.0 /100.0 |
1 /1 |
IL17F_HUMAN Interleukin-17F | |
5vb9[2] | G |
CL
CHLORIDE ION[1 atoms] |
B | 0.0 /62.7 |
1 /2 |
IL17_HUMAN Interleukin-17A | |
8dy5[1] | G |
MG
MAGNESIUM ION[1 atoms] |
D | 100.0 /62.0 |
1 /1 |
IL17_HUMAN Interleukin-17A | |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
OTHERPOLY | |||||||
163 | pdb_id | contact mol | homologue | ||||
a3 | description | a4 | identity[%]5 | Ncon6 | description | ||
1jpy[1] | E | 2-acetamido-2-deoxy-alpha-D-glucopyranose-(1-4)-2-.. | B | 100.0 /100.0 |
2 /2 |
interleukin 17F | |
1jpy[1] | F | 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. | C | 100.0 /100.0 |
3 /3 |
interleukin 17F | |
3jvf[1] | D | 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. | A | 100.0 /100.0 |
3 /3 |
IL17F_HUMAN Interleukin-17F | |
6hgo[1] | E | 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-a.. | B | 100.0 /100.0 |
3 /3 |
IL17F_HUMAN Interleukin-17F | |
5n92[1] | C | 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-[al.. | B | 100.0 /100.0 |
3 /3 |
IL17F_HUMAN Interleukin-17F | |
5nan[1] | G | 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-[be.. | F | 100.0 /100.0 |
2 /2 |
IL17F_HUMAN Interleukin-17F | |
8ruu[1] | G | alpha-D-mannopyranose-(1-3)-beta-D-mannopyranose-(.. | C | 100.0 /100.0 |
4 /4 |
IL17F_HUMAN Interleukin-17F | |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
HOMO | |||||||
163 | pdb_id | contact mol | homologue | ||||
a3 | description | a4 | identity[%]5 | Ncon6 | description | ||
1jpy[18] | B | interleukin 17F[121 aa] | A | 100.0 /100.0 |
64 /64 |
interleukin 17F | |
7uwn[1] | E | IL17_HUMAN Interleukin-17A[93 aa] | D | 80.0 /64.4 |
30 /41 |
IL17_HUMAN Interleukin-17A | |
2vxs[5] | B | IL17_HUMAN INTERLEUKIN-17A[80 aa] | A | 80.0 /64.2 |
20 /20 |
IL17_HUMAN INTERLEUKIN-17A | |
4hr9[49] | B | IL17_HUMAN Interleukin-17A[93 aa] | A | 79.3 /62.7 |
29 /41 |
IL17_HUMAN Interleukin-17A | |
2vxs[1] | D | IL17_HUMAN INTERLEUKIN-17A[77 aa] | C | 85.0 /63.2 |
20 /20 |
IL17_HUMAN INTERLEUKIN-17A | |
5hhx[2] | B | IL17_HUMAN Interleukin-17A[10 aa] | A | 0.0 /61.6 |
1 /1 |
IL17_HUMAN Interleukin-17A | |
5hhv[2] | B | IL17_HUMAN Interleukin-17A[10 aa] | A | 0.0 /60.0 |
1 /1 |
IL17_HUMAN Interleukin-17A | |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
PRECIPITANT | |||||||
163 | pdb_id | contact mol | homologue | ||||
a3 | description | a4 | identity[%]5 | Ncon6 | description | ||
1jpy[1] | H |
SO4
SULFATE ION[5 atoms] |
C | 100.0 /100.0 |
2 /2 |
interleukin 17F | |
2vxs[4] | M |
SO4
SULFATE ION[5 atoms] |
A | 40.0 /64.2 |
5 /5 |
IL17_HUMAN INTERLEUKIN-17A | |
2vxs[1] | O |
SO4
SULFATE ION[5 atoms] |
B | 50.0 /63.2 |
2 /2 |
IL17_HUMAN INTERLEUKIN-17A | |
4qhu[1] | Q |
SO4
SULFATE ION[5 atoms] |
F | 40.0 /62.5 |
5 /5 |
IL17_HUMAN Interleukin-17A | |
6hgo[1] | I |
SO4
SULFATE ION[5 atoms] |
D | 100.0 /100.0 |
3 /3 |
IL17F_HUMAN Interleukin-17F | |
8b7w[4] | E |
SO4
SULFATE ION[5 atoms] |
B | 100.0 /60.4 |
2 /2 |
IL17_HUMAN Interleukin-17A | |
7wkx[1] | J |
ACY
ACETIC ACID[4 atoms] |
E | 66.7 /63.1 |
3 /3 |
IL17_HUMAN Interleukin-17A | |
4qhu[1] | L |
GOL
GLYCEROL[6 atoms] |
F | 0.0 /62.5 |
3 /3 |
IL17_HUMAN Interleukin-17A | |
7z2m[1] | M |
GOL
GLYCEROL[6 atoms] |
K | 0.0 /60.9 |
1 /1 |
IL17_HUMAN Interleukin-17A | |
8dyh[1] | D |
GOL
GLYCEROL[6 atoms] |
A | 100.0 /65.1 |
2 /2 |
IL17_HUMAN Interleukin-17A | |
8dyh[1] | D |
GOL
GLYCEROL[6 atoms] |
B | 66.7 /62.8 |
3 /3 |
IL17_HUMAN Interleukin-17A | |
5vb9[4] | E |
EDO
1,2-ETHANEDIOL[4 atoms] |
A | 75.0 /63.2 |
4 /4 |
IL17_HUMAN Interleukin-17A | |
5vb9[2] | F |
EDO
1,2-ETHANEDIOL[4 atoms] |
A | 100.0 /63.2 |
5 /5 |
IL17_HUMAN Interleukin-17A | |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. |