Contact Molecules for Homologous Proteins | ||||
[Full Bars] |
[SiteTable] |
|
[Back to Search Page] |
[Back to HOMCOS] |
[SupCon3D] |
[help] |
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100] | [show] [download] [help] |
PID | QueryLength | Homolgous Sequence in PDB | UniProt Query | TITLE |
11352 | 740 | 3 | Q92499(DDX1_HUMAN) | RecName: Full=ATP-dependent RNA helicase DDX1; EC=3.6.4.13 ;AltName: Full=DEAD box protein 1;AltName: Full=DEAD box protein retinoblastoma; Short=DBP-RB; |
QUERYSEQ |
MAAFSEMGVMPEIAQAVEEMDWLLPTDIQAESIPLILGGGDVLMAAETGSGKTGAFSIPVIQIVYETLKDQQEGKKGKTTIKTGASVLNKWQMNPYDRGSAFAIGSDGLCCQSREVKEWHGCRATKGLMKGKHYYEVSCHDQGLCRVGWS TMQASLDLGTDKFGFGFGGTGKKSHNKQFDNYGEEFTMHDTIGCYLDIDKGHVKFSKNGKDLGLAFEIPPHMKNQALFPACVLKNAELKFNFGEEEFKFPPKDGFVALSKAPDGYIVKSQHSGNAQVTQTKFLPNAPKALIVEPSRELAE QTLNNIKQFKKYIDNPKLRELLIIGGVAARDQLSVLENGVDIVVGTPGRLDDLVSTGKLNLSQVRFLVLDEADGLLSQGYSDFINRMHNQIPQVTSDGKRLQVIVCSATLHSFDVKKLSEKIMHFPTWVDLKGEDSVPDTVHHVVVPVNP KTDRLWERLGKSHIRTDDVHAKDNTRPGANSPEMWSEAIKILKGEYAVRAIKEHKMDQAIIFCRTKIDCDNLEQYFIQQGGGPDKKGHQFSCVCLHGDRKPHERKQNLERFKKGDVRFLICTDVAARGIDIHGVPYVINVTLPDEKQNYV HRIGRVGRAERMGLAISLVATEKEKVWYHVCSSRGKGCYNTRLKEDGGCTIWYNEMQLLSEIEEHLNCTISQVEPDIKVPVDEFDGKVTYGQKRAAGGGSYKGHVDILAPTVQELAALEKEAQTSFLHLGYLPNQLFRTF |
740 | region | name | description |
1-740 | CHAIN | /note="ATP-dependent RNA helicase DDX1" /id="PRO_0000054986" | |
2-428 | DOMAIN | /note="Helicase ATP-binding" | |
70-247 | DOMAIN | /note="B30.2/SPRY" | |
493-681 | DOMAIN | /note="Helicase C-terminal" | |
1-525 | REGION | /note="Necessary for interaction with RELA" | |
1-448 | REGION | /note="Interaction with dsRNA" | |
1-295 | REGION | /note="Necessary for interaction with HNRNPK" | |
525-740 | REGION | /note="Necessary for interaction with HNRNPK" | |
536-631 | REGION | /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" | |
46-53 | BINDING | /ligand="ATP" /ligand_id="ChEBI:CHEBI:30616" | |
1-718 | DISORDER | predicted by DISOPRED |
MONOMER | |||||||
740 | |||||||
pdb_id | a1 | identity[%]2 | description | ||||
8tbx | A | 100.0 | DDX1_HUMAN DDX1_HUMAN ATP-dependent RNA helicase DDX1 | ||||
4xw3 | B | 100.0 | A3RJH1_HUMAN ATP-dependent RNA helicase DDX1 | ||||
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue. |
COMPOUND | |||||||
740 | pdb_id | contact mol | homologue | ||||
a3 | description | a4 | identity[%]5 | Ncon6 | description | ||
8tbx[1] | B |
ADP
ADENOSINE-5'-DIPHOSPHATE[27 atoms] |
A | 100.0 /100.0 |
15 /15 |
DDX1_HUMAN DDX1_HUMAN ATP-dependent RNA helicase DDX1 | |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
METAL | |||||||
740 | pdb_id | contact mol | homologue | ||||
a3 | description | a4 | identity[%]5 | Ncon6 | description | ||
8tbx[1] | C |
MG
MAGNESIUM ION[1 atoms] |
A | 100.0 /100.0 |
3 /3 |
DDX1_HUMAN DDX1_HUMAN ATP-dependent RNA helicase DDX1 | |
8tbx[1] | D |
ZN
ZINC ION[1 atoms] |
A | 100.0 /100.0 |
4 /4 |
DDX1_HUMAN DDX1_HUMAN ATP-dependent RNA helicase DDX1 | |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. |