Contact Molecules for Homologous Proteins | ||||
[Full Bars] |
[SiteTable] |
|
[Back to Search Page] |
[Back to HOMCOS] |
[SupCon3D] |
[help] |
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100] | [show] [download] [help] |
PID | QueryLength | Homolgous Sequence in PDB | UniProt Query | TITLE |
4093023 | 740 | 52 | Q92499(DDX1_HUMAN) | RecName: Full=ATP-dependent RNA helicase DDX1; EC=3.6.4.13 ;AltName: Full=DEAD box protein 1;AltName: Full=DEAD box protein retinoblastoma; Short=DBP-RB; |
QUERYSEQ |
MAAFSEMGVMPEIAQAVEEMDWLLPTDIQAESIPLILGGGDVLMAAETGSGKTGAFSIPVIQIVYETLKDQQEGKKGKTTIKTGASVLNKWQMNPYDRGSAFAIGSDGLCCQSREVKEWHGCRATKGLMKGKHYYEVSCHDQGLCRVGWS TMQASLDLGTDKFGFGFGGTGKKSHNKQFDNYGEEFTMHDTIGCYLDIDKGHVKFSKNGKDLGLAFEIPPHMKNQALFPACVLKNAELKFNFGEEEFKFPPKDGFVALSKAPDGYIVKSQHSGNAQVTQTKFLPNAPKALIVEPSRELAE QTLNNIKQFKKYIDNPKLRELLIIGGVAARDQLSVLENGVDIVVGTPGRLDDLVSTGKLNLSQVRFLVLDEADGLLSQGYSDFINRMHNQIPQVTSDGKRLQVIVCSATLHSFDVKKLSEKIMHFPTWVDLKGEDSVPDTVHHVVVPVNP KTDRLWERLGKSHIRTDDVHAKDNTRPGANSPEMWSEAIKILKGEYAVRAIKEHKMDQAIIFCRTKIDCDNLEQYFIQQGGGPDKKGHQFSCVCLHGDRKPHERKQNLERFKKGDVRFLICTDVAARGIDIHGVPYVINVTLPDEKQNYV HRIGRVGRAERMGLAISLVATEKEKVWYHVCSSRGKGCYNTRLKEDGGCTIWYNEMQLLSEIEEHLNCTISQVEPDIKVPVDEFDGKVTYGQKRAAGGGSYKGHVDILAPTVQELAALEKEAQTSFLHLGYLPNQLFRTF |
740 | region | name | description |
1-740 | CHAIN | /note="ATP-dependent RNA helicase DDX1" /id="PRO_0000054986" | |
2-428 | DOMAIN | /note="Helicase ATP-binding" | |
70-247 | DOMAIN | /note="B30.2/SPRY" | |
493-681 | DOMAIN | /note="Helicase C-terminal" | |
1-525 | REGION | /note="Necessary for interaction with RELA" | |
1-448 | REGION | /note="Interaction with dsRNA" | |
1-295 | REGION | /note="Necessary for interaction with HNRNPK" | |
525-740 | REGION | /note="Necessary for interaction with HNRNPK" | |
536-631 | REGION | /note="Necessary for interaction with replicase polyprotein 1ab nsp14 of IBV" | |
46-53 | BINDING | /ligand="ATP" /ligand_id="ChEBI:CHEBI:30616" | |
1-718 | DISORDER | predicted by DISOPRED |
MONOMER | |||||||
740 | |||||||
pdb_id | a1 | identity[%]2 | description | ||||
8tbx | A | 100.0 | DDX1_HUMAN DDX1_HUMAN ATP-dependent RNA helicase DDX1 | ||||
4xw3 | B | 100.0 | A3RJH1_HUMAN ATP-dependent RNA helicase DDX1 | ||||
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue. |
HETERO | |||||||
740 | pdb_id | contact mol | homologue | ||||
a3 | description | a4 | identity[%]5 | Ncon6 | description | ||
8v84[1] | AA | RL23A_YEAST 60S ribosomal protein L23-A[122 aa] | C | 25.0 /46.1 |
4 /8 |
DBP10_YEAST ATP-dependent RNA helicase DBP10 | |
3peu[2] | B | GLE1_YEAST Nucleoporin GLE1[295 aa] | A | 36.4 /46.0 |
11 /24 |
DBP5_YEAST ATP-dependent RNA helicase DBP5 | |
3peu[2] | B | GLE1_YEAST Nucleoporin GLE1[295 aa] | A | 40.0 /46.0 |
10 /14 |
DBP5_YEAST ATP-dependent RNA helicase DBP5 | |
6elz[2] | FA | CIC1_YEAST Proteasome-interacting protein CIC1[257 aa] | HA | 0.0 /44.3 |
1 /15 |
HAS1_YEAST ATP-dependent RNA helicase HAS1 | |
8eti[2] | GA | RL36B_SCHPO 60S ribosomal protein L36-B[85 aa] | J | 0.0 /41.9 |
3 /3 |
HAS1_SCHPO ATP-dependent RNA helicase has1 | |
6yvh[1] | A | CWC22_HUMAN Pre-mRNA-splicing factor CWC22 homolog[274 aa] | F | 42.9 /40.6 |
7 /23 |
IF4A3_HUMAN Eukaryotic initiation factor 4A-III | |
6yvh[1] | E | CWC22_HUMAN Pre-mRNA-splicing factor CWC22 homolog[272 aa] | F | 50.0 /40.6 |
12 /12 |
IF4A3_HUMAN Eukaryotic initiation factor 4A-III | |
5nt7[2] | B | OSKA_DROME Maternal effect protein oskar[92 aa] | A | 34.8 /40.2 |
23 /23 |
VASA1_DROME ATP-dependent RNA helicase vasa, isoform A | |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
NUCLEOTIDE | |||||||
740 | pdb_id | contact mol | homologue | ||||
a3 | description | a4 | identity[%]5 | Ncon6 | description | ||
6elz[1] | A | 25S ribosomal RNA | HA | 0.0 /44.3 |
1 /5 |
HAS1_YEAST ATP-dependent RNA helicase HAS1 | |
4db2[1] | I | 5'-R(*GP*GP*GP*CP*GP*GP*GP*CP*CP*CP*GP*CP*CP*C)-3'.. | D | 100.0 /43.1 |
6 /12 |
MS116_YEAST ATP-dependent RNA helicase MSS116, mitochondrial | |
4db2[1] | J | 5'-R(*GP*GP*GP*CP*GP*GP*GP*CP*CP*CP*GP*CP*CP*C)-3'.. | D | 50.0 /43.1 |
2 /6 |
MS116_YEAST ATP-dependent RNA helicase MSS116, mitochondrial | |
8eti[1] | A | RNA (1564-MER) | J | 20.0 /41.9 |
5 /6 |
HAS1_SCHPO ATP-dependent RNA helicase has1 | |
8eup[1] | A | RNA (1422-MER) | J | 28.6 /41.8 |
7 /10 |
S6CCW7_SCHPM RNA helicase | |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
COMPOUND | |||||||
740 | pdb_id | contact mol | homologue | ||||
a3 | description | a4 | identity[%]5 | Ncon6 | description | ||
8tbx[1] | B |
ADP
ADENOSINE-5'-DIPHOSPHATE[27 atoms] |
A | 100.0 /100.0 |
15 /15 |
DDX1_HUMAN DDX1_HUMAN ATP-dependent RNA helicase DDX1 | |
5gju[1] | B |
AMP
ADENOSINE MONOPHOSPHATE[23 atoms] |
A | 72.7 /40.4 |
11 /11 |
DEAD_ECOLI ATP-dependent RNA helicase DeaD | |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
METAL | |||||||
740 | pdb_id | contact mol | homologue | ||||
a3 | description | a4 | identity[%]5 | Ncon6 | description | ||
1fuk[1] | B |
ZN
ZINC ION[1 atoms] |
A | 33.3 /42.6 |
3 /3 |
IF4A_YEAST EUKARYOTIC INITIATION FACTOR 4A | |
2rb4[1] | F |
ZN
ZINC ION[1 atoms] |
A | 50.0 /41.7 |
2 /2 |
DDX25_HUMAN ATP-dependent RNA helicase DDX25 | |
8tbx[1] | D |
ZN
ZINC ION[1 atoms] |
A | 100.0 /100.0 |
4 /4 |
DDX1_HUMAN DDX1_HUMAN ATP-dependent RNA helicase DDX1 | |
8tbx[1] | C |
MG
MAGNESIUM ION[1 atoms] |
A | 100.0 /100.0 |
3 /3 |
DDX1_HUMAN DDX1_HUMAN ATP-dependent RNA helicase DDX1 | |
2rb4[1] | C |
CL
CHLORIDE ION[1 atoms] |
A | 100.0 /41.7 |
1 /1 |
DDX25_HUMAN ATP-dependent RNA helicase DDX25 | |
2rb4[1] | D |
CL
CHLORIDE ION[1 atoms] |
A | 50.0 /41.7 |
2 /2 |
DDX25_HUMAN ATP-dependent RNA helicase DDX25 | |
3eaq[1] | C |
CL
CHLORIDE ION[1 atoms] |
A | 100.0 /42.5 |
3 /3 |
Q72GF3_THET2 Heat resistant RNA dependent ATPase | |
3eaq[1] | D |
CL
CHLORIDE ION[1 atoms] |
B | 0.0 /41.9 |
1 /3 |
Q72GF3_THET2 Heat resistant RNA dependent ATPase | |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
PRECIPITANT | |||||||
740 | pdb_id | contact mol | homologue | ||||
a3 | description | a4 | identity[%]5 | Ncon6 | description | ||
2rb4[2] | E |
SO4
SULFATE ION[5 atoms] |
A | 0.0 /41.7 |
2 /2 |
DDX25_HUMAN ATP-dependent RNA helicase DDX25 | |
3peu[4] | C |
SO4
SULFATE ION[5 atoms] |
A | 100.0 /46.0 |
2 /2 |
DBP5_YEAST ATP-dependent RNA helicase DBP5 | |
3peu[4] | D |
GOL
GLYCEROL[6 atoms] |
A | 57.1 /46.0 |
7 /7 |
DBP5_YEAST ATP-dependent RNA helicase DBP5 | |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. |