Contact Molecules for Homologous Proteins | ||||
[Full Bars] |
[SiteTable] |
|
[Back to Search Page] |
[Back to HOMCOS] |
[SupCon3D] |
[help] |
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100] | [show] [download] [help] |
PID | QueryLength | Homolgous Sequence in PDB | UniProt Query | TITLE |
2727836 | 179 | 12 | Q13241(KLRD1_HUMAN) | RecName: Full=Natural killer cells antigen CD94;AltName: Full=KP43;AltName: Full=Killer cell lectin-like receptor subfamily D member 1;AltName: Full=NK cell receptor;AltName: CD_antigen=CD94 ; |
QUERYSEQ |
MAVFKTTLWRLISGTLGIICLSLMSTLGILLKNSFTKLSIEPAFTPGPNIELQKDSDCCSCQEKWVGYRCNCYFISSEQKTWNESRHLCASQKSSLLQLQNTDELDFMSSSQQFYWIGLSYSEEHTAWLWENGSALSQYLFPSFETFNTK NCIAYNPNGNALDESCEDKNRYICKQQLI |
179 | region | name | description |
1-179 | CHAIN | /note="Natural killer cells antigen CD94" /id="PRO_0000046587" | |
1-10 | TOPO_DOM | /note="Cytoplasmic" | |
11-31 | TRANSMEM | /note="Helical; Signal-anchor for type II membrane protein" | |
32-179 | TOPO_DOM | /note="Extracellular" | |
68-175 | DOMAIN | /note="C-type lectin" | |
1-34 | DISORDER | predicted by DISOPRED |
MONOMER | |||||||
179 | |||||||
pdb_id | a1 | identity[%]2 | description | ||||
3cdg | G | 100.0 | KLRD1_HUMAN Natural killer cells antigen CD94 | ||||
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue. |
HETERO | |||||||
179 | pdb_id | contact mol | homologue | ||||
a3 | description | a4 | identity[%]5 | Ncon6 | description | ||
3bdw[6] | B | NKG2A_HUMAN NKG2-A/NKG2-B type II integral membrane protein[11.. | A | 100.0 /100.0 |
17 /17 |
KLRD1_HUMAN Natural killer cells antigen CD94 | |
3cdg[4] | A | HLAE_HUMAN HLA class I histocompatibility antigen, alpha chai.. | C | 100.0 /100.0 |
13 /13 |
KLRD1_HUMAN Natural killer cells antigen CD94 | |
3cdg[4] | I | HLAG_HUMAN leader peptide of HLA class I histocompatibility a.. | C | 100.0 /100.0 |
4 /4 |
KLRD1_HUMAN Natural killer cells antigen CD94 | |
8umo[1] | A | HA15_MOUSE H-2 class I histocompatibility antigen, D-37 alpha.. | C | 45.5 /57.5 |
11 /11 |
E9Q3T9_MOUSE Killer cell lectin-like receptor, subfamily D, mem.. | |
8umo[1] | D | Q9WU32_MOUSE Killer cell lectin-like receptor subfamily C, memb.. | C | 71.4 /57.5 |
14 /14 |
E9Q3T9_MOUSE Killer cell lectin-like receptor, subfamily D, mem.. | |
8umo[1] | E | HA1L_MOUSE Qdm peptide[9 aa] | C | 33.3 /57.5 |
3 /3 |
E9Q3T9_MOUSE Killer cell lectin-like receptor, subfamily D, mem.. | |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
PRECIPITANT | |||||||
179 | pdb_id | contact mol | homologue | ||||
a3 | description | a4 | identity[%]5 | Ncon6 | description | ||
8jah[1] | E |
SO4
SULFATE ION[5 atoms] |
B | 0.0 /40.9 |
2 /2 |
CL12A_HUMAN C-type lectin domain family 12 member A | |
8w8t[1] | F |
SO4
SULFATE ION[5 atoms] |
B | 0.0 /40.9 |
4 /4 |
CL12A_HUMAN C-type lectin domain family 12 member A | |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. |