Contact Molecules for Homologous Proteins | ||||
[Full Bars] |
[SiteTable] |
|
[Back to Search Page] |
[Back to HOMCOS] |
[SupCon3D] |
[help] |
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100] | [show] [download] [help] |
PID | QueryLength | Homolgous Sequence in PDB | UniProt Query | TITLE |
1682730 | 498 | 69 | Q13568(IRF5_HUMAN) | RecName: Full=Interferon regulatory factor 5 ; Short=IRF-5 ; |
QUERYSEQ |
MNQSIPVAPTPPRRVRLKPWLVAQVNSCQYPGLQWVNGEKKLFCIPWRHATRHGPSQDGDNTIFKAWAKETGKYTEGVDEADPAKWKANLRCALNKSRDFRLIYDGPRDMPPQPYKIYEVCSNGPAPTDSQPPEDYSFGAGEEEEEEEEL QRMLPSLSLTEDVKWPPTLQPPTLRPPTLQPPTLQPPVVLGPPAPDPSPLAPPPGNPAGFRELLSEVLEPGPLPASLPPAGEQLLPDLLISPHMLPLTDLEIKFQYRGRPPRALTISNPHGCRLFYSQLEATQEQVELFGPISLEQVRFP SPEDIPSDKQRFYTNQLLDVLDRGLILQLQGQDLYAIRLCQCKVFWSGPCASAHDSCPNPIQREVKTKLFSLEHFLNELILFQKGQTNTPPPFEIFFCFGEEWPDRKPREKKLITVQVVPVAARLLLEMFSGELSWSADSIRLQISNPDL KDRMVEQFKELHHIWQSQQRLQPVAQAPPGAGLGVGQGPWPMHPAGMQ |
498 | region | name | description |
1-498 | CHAIN | /note="Interferon regulatory factor 5" /id="PRO_0000154558" | |
14-122 | DNA_BIND | /note="IRF tryptophan pentad repeat" | |
121-207 | REGION | /note="Disordered" | |
478-498 | REGION | /note="Disordered" | |
169-206 | COMPBIAS | /note="Pro residues" | |
1-498 | DISORDER | predicted by DISOPRED |
MONOMER | |||||||
498 | |||||||
pdb_id | a1 | identity[%]2 | description | ||||
3dsh | A | 99.6 | IRF5_HUMAN Interferon regulatory factor 5 | ||||
7rh2 | A | 46.2 | Q99419_HUMAN ICSAT transcription factor | ||||
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue. |
HETERO | |||||||
498 | pdb_id | contact mol | homologue | ||||
a3 | description | a4 | identity[%]5 | Ncon6 | description | ||
1t2k[1] | F | ATF2_HUMAN Cyclic-AMP-dependent transcription factor ATF-2[61.. | C | 33.3 /44.3 |
3 /3 |
IRF3_HUMAN Interferon regulatory factor 3 | |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
NUCLEOTIDE | |||||||
498 | pdb_id | contact mol | homologue | ||||
a3 | description | a4 | identity[%]5 | Ncon6 | description | ||
8jkl[8] | C | GATA-Forward | E | 70.0 /48.0 |
10 /10 |
F2Z3D5_HUMAN Interferon regulatory factor 4 | |
8jkl[8] | D | GATA-Reverse | E | 66.7 /48.0 |
9 /11 |
F2Z3D5_HUMAN Interferon regulatory factor 4 | |
7jm4[8] | A | Interferon-Stimulated Response Elements | C | 70.0 /45.3 |
10 /10 |
IRF4_HUMAN Interferon regulatory factor 4 | |
7jm4[6] | B | Interferon-Stimulated Response Elements | C | 55.6 /45.3 |
9 /9 |
IRF4_HUMAN Interferon regulatory factor 4 | |
7rh2[2] | F | DNA (5'-D(*GP*CP*TP*TP*TP*CP*TP*CP*GP*GP*TP*TP*TP*.. | G | 70.0 /46.2 |
10 /11 |
Q99419_HUMAN ICSAT transcription factor | |
7o56[3] | B | DNA (5'-D(P*AP*AP*TP*AP*AP*AP*AP*GP*AP*AP*AP*CP*CP.. | A | 77.8 /45.0 |
9 /9 |
IRF4_HUMAN Interferon regulatory factor 4 | |
7o56[2] | C | DNA (5'-D(P*TP*TP*TP*AP*CP*TP*TP*TP*CP*GP*GP*TP*TP.. | A | 58.3 /45.0 |
12 /13 |
IRF4_HUMAN Interferon regulatory factor 4 | |
8jkn[4] | A | GAAA-Forward | C | 80.0 /45.3 |
10 /10 |
F2Z3D5_HUMAN Interferon regulatory factor 4 | |
8jkn[4] | B | GAAA-Reverse | C | 50.0 /45.3 |
10 /12 |
F2Z3D5_HUMAN Interferon regulatory factor 4 | |
8jkq[4] | A | GACA-Forward | C | 77.8 /44.8 |
9 /9 |
F2Z3D5_HUMAN Interferon regulatory factor 4 | |
8jkq[4] | B | GACA-Reverse | C | 54.5 /44.8 |
11 /12 |
F2Z3D5_HUMAN Interferon regulatory factor 4 | |
8jks[4] | A | GAGA-Forward | C | 75.0 /45.3 |
8 /8 |
F2Z3D5_HUMAN Interferon regulatory factor 4 | |
8jks[4] | B | GAGA-Reverse | C | 54.5 /45.3 |
11 /13 |
F2Z3D5_HUMAN Interferon regulatory factor 4 | |
2o61[1] | A | 36-MER | C | 45.5 /45.1 |
11 /34 |
TF65_HUMAN IRF7_HUMAN IRF3_HUMAN Transcription factor p65/Interferon regulatory fac.. | |
2o61[1] | B | 34-MER | C | 38.5 /45.1 |
13 /36 |
TF65_HUMAN IRF7_HUMAN IRF3_HUMAN Transcription factor p65/Interferon regulatory fac.. | |
2pi0[4] | A | PRDIII-I region of human interferon-B promoter str.. | C | 50.0 /46.9 |
12 /12 |
IRF3_HUMAN Interferon regulatory factor 3 | |
2pi0[4] | B | PRDIII-I region of human interferon-B promoter str.. | C | 54.5 /46.9 |
11 /13 |
IRF3_HUMAN Interferon regulatory factor 3 | |
7ogs[4] | C | DNA (5'-D(P*TP*GP*TP*AP*CP*TP*TP*TP*CP*GP*GP*TP*TP.. | A | 63.6 /45.0 |
11 /13 |
IRF4_HUMAN Interferon regulatory factor 4 | |
7ogs[4] | D | DNA (5'-D(P*AP*TP*AP*AP*CP*TP*GP*AP*AP*AP*CP*CP*GP.. | A | 75.0 /45.0 |
12 /12 |
IRF4_HUMAN Interferon regulatory factor 4 | |
7oot[2] | C | DNA (5'-D(P*TP*CP*AP*AP*CP*TP*GP*AP*AP*AP*CP*CP*GP.. | A | 81.8 /45.0 |
11 /11 |
IRF4_HUMAN Interferon regulatory factor 4 | |
7oot[2] | D | DNA (5'-D(P*AP*GP*CP*TP*TP*TP*CP*TP*CP*GP*GP*TP*TP.. | A | 41.7 /45.0 |
12 /13 |
IRF4_HUMAN Interferon regulatory factor 4 | |
1t2k[2] | A | 31-MER | C | 55.6 /44.3 |
9 /9 |
IRF3_HUMAN Interferon regulatory factor 3 | |
1t2k[2] | B | 31-MER | C | 46.7 /44.3 |
15 /17 |
IRF3_HUMAN Interferon regulatory factor 3 | |
2o6g[4] | A | interferon-b enhancer | C | 50.0 /44.3 |
12 /12 |
IRF3_HUMAN Interferon regulatory factor 3 | |
2o6g[4] | B | interferon-b enhancer | C | 42.9 /44.3 |
14 /16 |
IRF3_HUMAN Interferon regulatory factor 3 | |
2irf[4] | F | DNA (5'-D(*TP*TP*CP*AP*CP*TP*TP*TP*CP*AP*CP*(5IU)P.. | G | 70.0 /43.9 |
10 /10 |
IRF2_MOUSE INTERFERON REGULATORY FACTOR 2 | |
2irf[3] | A | DNA (5'-D(P*AP*AP*GP*TP*GP*AP*AP*AP*GP*(5IU)P*GP*A.. | H | 63.6 /43.9 |
11 /11 |
IRF2_MOUSE INTERFERON REGULATORY FACTOR 2 | |
2irf[2] | E | DNA (5'-D(*TP*TP*CP*AP*CP*TP*TP*TP*CP*AP*CP*(5IU)P.. | I | 70.0 /43.9 |
10 /10 |
IRF2_MOUSE INTERFERON REGULATORY FACTOR 2 | |
1if1[2] | A | DNA (26-MER) | C | 68.2 /42.9 |
22 /22 |
IRF1_MOUSE PROTEIN (INTERFERON REGULATORY FACTOR 1) | |
1if1[2] | B | DNA (26-MER) | C | 50.0 /42.9 |
2 /2 |
IRF1_MOUSE PROTEIN (INTERFERON REGULATORY FACTOR 1) | |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
METAL | |||||||
498 | pdb_id | contact mol | homologue | ||||
a3 | description | a4 | identity[%]5 | Ncon6 | description | ||
3qu3[3] | D |
NA
SODIUM ION[1 atoms] |
A | 50.0 /41.5 |
4 /4 |
IRF7_MOUSE Interferon regulatory factor 7 | |
3qu6[1] | K |
NA
SODIUM ION[1 atoms] |
A | 50.0 /45.8 |
2 /2 |
Q7Z5G6_HUMAN IRF3 protein | |
3qu6[2] | L |
NA
SODIUM ION[1 atoms] |
A | 40.0 /45.8 |
5 /5 |
Q7Z5G6_HUMAN IRF3 protein | |
3qu6[2] | D |
ZN
ZINC ION[1 atoms] |
A | 0.0 /45.8 |
2 /2 |
Q7Z5G6_HUMAN IRF3 protein | |
3qu6[1] | E |
ZN
ZINC ION[1 atoms] |
A | 50.0 /45.8 |
2 /2 |
Q7Z5G6_HUMAN IRF3 protein | |
3qu6[2] | F |
ZN
ZINC ION[1 atoms] |
A | 50.0 /45.8 |
2 /2 |
Q7Z5G6_HUMAN IRF3 protein | |
3qu6[4] | G |
ZN
ZINC ION[1 atoms] |
A | 25.0 /45.8 |
4 /4 |
Q7Z5G6_HUMAN IRF3 protein | |
3qu6[4] | H |
CL
CHLORIDE ION[1 atoms] |
A | 25.0 /45.8 |
4 /4 |
Q7Z5G6_HUMAN IRF3 protein | |
3qu6[1] | I |
CL
CHLORIDE ION[1 atoms] |
A | 0.0 /45.8 |
1 /1 |
Q7Z5G6_HUMAN IRF3 protein | |
3qu6[2] | M |
CL
CHLORIDE ION[1 atoms] |
A | 25.0 /45.8 |
4 /4 |
Q7Z5G6_HUMAN IRF3 protein | |
5bvi[2] | C |
CL
CHLORIDE ION[1 atoms] |
A | 66.7 /42.1 |
6 /6 |
Q5SUZ4_MOUSE Interferon regulatory factor 4 | |
5bvi[1] | D |
CL
CHLORIDE ION[1 atoms] |
A | 16.7 /42.1 |
6 /6 |
Q5SUZ4_MOUSE Interferon regulatory factor 4 | |
5bvi[1] | E |
CL
CHLORIDE ION[1 atoms] |
A | 50.0 /42.1 |
2 /2 |
Q5SUZ4_MOUSE Interferon regulatory factor 4 | |
6td4[1] | B |
CL
CHLORIDE ION[1 atoms] |
A | 0.0 /44.7 |
1 /1 |
IRF4_HUMAN Interferon regulatory factor 4 | |
2irf[6] | M |
K
POTASSIUM ION[1 atoms] |
G | 25.0 /43.9 |
4 /4 |
IRF2_MOUSE INTERFERON REGULATORY FACTOR 2 | |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
HOMO | |||||||
498 | pdb_id | contact mol | homologue | ||||
a3 | description | a4 | identity[%]5 | Ncon6 | description | ||
3dsh[2] | A | IRF5_HUMAN Interferon regulatory factor 5[236 aa] | A | 98.4 /99.6 |
62 /62 |
IRF5_HUMAN Interferon regulatory factor 5 | |
7o56[1] | E | IRF4_HUMAN Interferon regulatory factor 4[112 aa] | D | 50.0 /45.3 |
2 /2 |
IRF4_HUMAN Interferon regulatory factor 4 | |
7o56[1] | D | IRF4_HUMAN Interferon regulatory factor 4[109 aa] | E | 0.0 /45.3 |
2 /2 |
IRF4_HUMAN Interferon regulatory factor 4 | |
2o6g[3] | E | IRF3_HUMAN Interferon regulatory factor 3[110 aa] | C | 66.7 /44.3 |
3 /3 |
IRF3_HUMAN Interferon regulatory factor 3 | |
2o6g[2] | C | IRF3_HUMAN Interferon regulatory factor 3[110 aa] | E | 0.0 /44.3 |
3 /3 |
IRF3_HUMAN Interferon regulatory factor 3 | |
2pi0[1] | C | IRF3_HUMAN Interferon regulatory factor 3[98 aa] | E | 0.0 /45.2 |
1 /1 |
IRF3_HUMAN Interferon regulatory factor 3 | |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. | |||||||
PRECIPITANT | |||||||
498 | pdb_id | contact mol | homologue | ||||
a3 | description | a4 | identity[%]5 | Ncon6 | description | ||
7oot[1] | E |
PO4
PHOSPHATE ION[5 atoms] |
B | 0.0 /45.0 |
2 /2 |
IRF4_HUMAN Interferon regulatory factor 4 | |
3qu3[1] | F |
EDO
1,2-ETHANEDIOL[4 atoms] |
B | 50.0 /41.9 |
2 /2 |
IRF7_MOUSE Interferon regulatory factor 7 | |
3qu3[2] | G |
EDO
1,2-ETHANEDIOL[4 atoms] |
B | 33.3 /41.9 |
3 /3 |
IRF7_MOUSE Interferon regulatory factor 7 | |
3qu3[1] | J |
EDO
1,2-ETHANEDIOL[4 atoms] |
C | 66.7 /41.5 |
3 /5 |
IRF7_MOUSE Interferon regulatory factor 7 | |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. |