Contact Molecules for Homologous Proteins | ||||
[Full Bars] |
[SiteTable] |
|
[Back to Search Page] |
[Back to HOMCOS] |
[SupCon3D] |
[help] |
seq_id(%): [0] [30] [40] [50] [60] [70] [80] [90] [95] [100] | [show] [download] [help] |
PID | QueryLength | Homolgous Sequence in PDB | UniProt Query | TITLE |
1682730 | 498 | 1 | Q13568(IRF5_HUMAN) | RecName: Full=Interferon regulatory factor 5 ; Short=IRF-5 ; |
QUERYSEQ |
MNQSIPVAPTPPRRVRLKPWLVAQVNSCQYPGLQWVNGEKKLFCIPWRHATRHGPSQDGDNTIFKAWAKETGKYTEGVDEADPAKWKANLRCALNKSRDFRLIYDGPRDMPPQPYKIYEVCSNGPAPTDSQPPEDYSFGAGEEEEEEEEL QRMLPSLSLTEDVKWPPTLQPPTLRPPTLQPPTLQPPVVLGPPAPDPSPLAPPPGNPAGFRELLSEVLEPGPLPASLPPAGEQLLPDLLISPHMLPLTDLEIKFQYRGRPPRALTISNPHGCRLFYSQLEATQEQVELFGPISLEQVRFP SPEDIPSDKQRFYTNQLLDVLDRGLILQLQGQDLYAIRLCQCKVFWSGPCASAHDSCPNPIQREVKTKLFSLEHFLNELILFQKGQTNTPPPFEIFFCFGEEWPDRKPREKKLITVQVVPVAARLLLEMFSGELSWSADSIRLQISNPDL KDRMVEQFKELHHIWQSQQRLQPVAQAPPGAGLGVGQGPWPMHPAGMQ |
498 | region | name | description |
1-498 | CHAIN | /note="Interferon regulatory factor 5" /id="PRO_0000154558" | |
14-122 | DNA_BIND | /note="IRF tryptophan pentad repeat" | |
121-207 | REGION | /note="Disordered" | |
478-498 | REGION | /note="Disordered" | |
169-206 | COMPBIAS | /note="Pro residues" | |
1-498 | DISORDER | predicted by DISOPRED |
MONOMER | |||||||
498 | |||||||
pdb_id | a1 | identity[%]2 | description | ||||
3dsh | A | 99.6 | IRF5_HUMAN Interferon regulatory factor 5 | ||||
1.a1:asym_id for the homologue. 2.identity[%]2:sequence identity between the query and the homologue. |
HOMO | |||||||
498 | pdb_id | contact mol | homologue | ||||
a3 | description | a4 | identity[%]5 | Ncon6 | description | ||
3dsh[2] | A | IRF5_HUMAN Interferon regulatory factor 5[236 aa] | A | 98.4 /99.6 |
62 /62 |
IRF5_HUMAN Interferon regulatory factor 5 | |
3.a3:asym_id for the contact molecule. 4.a4:asym_id for the template homologue. 5.identity[%]5:sequence identity between the query and the template homologue only for the contact residues. Number after the slash / is sequence identity for all the aligned region. 6.Ncon6:number of aligned contact residues for the query. Number after the slash / is number of contact residues in the template homologue. |